Mouse Insulin C- peptide

Mouse Insulin C- peptide

Contact us: [email protected]

Mouse Insulin- like peptide INSL5, Insl5 ELISA KIT

ELI-43454m 96 Tests
EUR 1038

Mouse Insulin- like peptide INSL6, Insl6 ELISA KIT

ELI-13429m 96 Tests
EUR 1038

Mouse Insulin-like peptide INSL5 (INSL5) ELISA Kit

abx574867-96tests 96 tests
EUR 801.6

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

CSB-EL011749MO-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

1-CSB-EL011749MO
  • EUR 964.80
  • EUR 6118.80
  • EUR 3244.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Insulin Blocking Peptide

20-abx064168
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Blocking Peptide

20-abx064169
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Blocking Peptide

AF5109-BP 1mg
EUR 234

ELISA kit for Human Insulin-like peptide INSL5,Insulin-like peptide 5

EK2663 96 tests
EUR 663.6
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Insulin-like peptide INSL5,Insulin-like peptide 5 in samples from serum, plasma, tissue homogenates and other biological fluids.

Insulin Receptor (INSR) Peptide

20-abx266328
  • EUR 594.00
  • EUR 978.00
  • EUR 427.20
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Receptor Blocking Peptide

AF4692-BP 1mg
EUR 234

Insulin Receptor (INSR) Amide Peptide

20-abx266403
  • EUR 627.60
  • EUR 1045.20
  • EUR 460.80
  • 10 mg
  • 25 mg
  • 5 mg

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

RXFP1 ELISA Kit| Mouse Relaxin/Insulin Like Family Peptide Recep

EF012910 96 Tests
EUR 826.8

Insulin Receptor (INSR) Blocking Peptide

20-abx062798
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Receptor (INSR) Blocking Peptide

20-abx161901
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Receptor beta Blocking Peptide

DF6088-BP 1mg
EUR 234

Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]

INSB25-P 500 ug
EUR 416.4

Goat Anti-Human/mouse/rat Insulin chain A peptide IgG, aff pure

INSA21-A 100 ul
EUR 578.4

Insulin Receptor (1142-1153) (Biotin) Peptide

20-abx266416
  • EUR 627.60
  • EUR 1045.20
  • EUR 460.80
  • 10 mg
  • 25 mg
  • 5 mg

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit

abx254542-96tests 96 tests
EUR 848.4

Mouse Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) ELISA Kit

abx390435-96tests 96 tests
EUR 1093.2

Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit

EM0166 96T
EUR 628.92
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 9.375pg/ml

Monoclonal Anti-Human/mouse/rat Insulin chain B peptide IgG, aff pure

INSB22-M 100 ul
EUR 578.4

Insulin Like Growth Factor 1 (IGF1) Peptide

20-abx266444
  • EUR 661.20
  • EUR 1111.20
  • EUR 477.60
  • 10 mg
  • 25 mg
  • 5 mg

ELISA kit for Mouse RXFP1 (Relaxin/Insulin Like Family Peptide Receptor 1)

E-EL-M1010 1 plate of 96 wells
EUR 640.8
Description: A sandwich ELISA kit for quantitative measurement of Mouse RXFP1 (Relaxin/Insulin Like Family Peptide Receptor 1) in samples from Serum, Plasma, Cell supernatant

Insulin Receptor (1142-1153), amide (Biotin) Peptide

20-abx266464
  • EUR 661.20
  • EUR 1111.20
  • EUR 477.60
  • 10 mg
  • 25 mg
  • 5 mg

Kinase Domain of Insulin Receptor (1) Peptide

20-abx266352
  • EUR 610.80
  • EUR 1028.40
  • EUR 444.00
  • 10 mg
  • 25 mg
  • 5 mg

Kinase Domain of Insulin Receptor (2) Peptide

20-abx266448
  • EUR 661.20
  • EUR 1111.20
  • EUR 477.60
  • 10 mg
  • 25 mg
  • 5 mg

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide

20-abx068858
  • EUR 844.80
  • EUR 343.20
  • EUR 2614.80
  • EUR 1011.60
  • EUR 610.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide

20-abx068859
  • EUR 878.40
  • EUR 343.20
  • EUR 2766.00
  • EUR 1062.00
  • EUR 627.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Insulin- like peptide INSL6, INSL6 ELISA KIT

ELI-12379h 96 Tests
EUR 988.8

Human Insulin- like peptide INSL5, INSL5 ELISA KIT

ELI-20454h 96 Tests
EUR 988.8

Insulin Like Growth Factor 1 (IGF1) (30-41) Peptide

20-abx266288
  • EUR 594.00
  • EUR 978.00
  • EUR 427.20
  • 10 mg
  • 25 mg
  • 5 mg

Bovine Insulin- like peptide INSL6, INSL6 ELISA KIT

ELI-42113b 96 Tests
EUR 1113.6

Human Insulin-like peptide INSL5 (INSL5) ELISA Kit

abx570706-96tests 96 tests
EUR 801.6

Human Insulin-like peptide INSL5(INSL5) ELISA kit

CSB-EL011749HU-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Insulin-like peptide INSL5(INSL5) ELISA kit

1-CSB-EL011749HU
  • EUR 964.80
  • EUR 6118.80
  • EUR 3244.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

IGF-I Receptor/Insulin Receptor Blocking Peptide

AF4697-BP 1mg
EUR 234

Insulin Like Growth Factor 1 (IGF1) (1-3) Peptide

20-abx265710
  • EUR 393.60
  • EUR 594.00
  • EUR 326.40
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Like Growth Factor 1 (IGF1) Analog Peptide

20-abx266295
  • EUR 594.00
  • EUR 978.00
  • EUR 427.20
  • 10 mg
  • 25 mg
  • 5 mg

Mouse/rat/hamster/Insulin A chain peptide (90-110 aa; Cys-95-Cys100) [GIVDQCCTSICSLYQLENYCN]

INSA15-P 500 ug
EUR 343.2

Kinase Domain of Insulin Receptor (2) (Biotin) Peptide

20-abx266404
  • EUR 627.60
  • EUR 1045.20
  • EUR 460.80
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Like Growth Factor 1 (IGF1) Blocking Peptide

20-abx161136
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Receptor (INSR) (Phospho-Y1355) Blocking Peptide

20-abx161651
  • EUR 376.80
  • EUR 610.80
  • 1 mg
  • 5 mg

Insulin Receptor (INSR) (Phospho-Y1361) Blocking Peptide

20-abx161652
  • EUR 376.80
  • EUR 610.80
  • 1 mg
  • 5 mg

ELISA kit for Human Insulin-like peptide INSL6 (INSL6)

KTE62243-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Insulin-like peptide INSL6 (INSL6)

KTE62243-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Insulin-like peptide INSL6 (INSL6)

KTE62243-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)

KTE10416-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)

KTE10416-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)

KTE10416-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Human Early placenta insulin- like peptide, INSL4 ELISA KIT

ELI-03359h 96 Tests
EUR 988.8

Human Early placenta insulin-like peptide(INSL4) ELISA kit

CSB-EL011748HU-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Human Early placenta insulin-like peptide (INSL4) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Early placenta insulin-like peptide(INSL4) ELISA kit

1-CSB-EL011748HU
  • EUR 964.80
  • EUR 6118.80
  • EUR 3244.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human Early placenta insulin-like peptide(INSL4) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human INSL4/ Early placenta insulin-like peptide ELISA Kit

E1323Hu 1 Kit
EUR 685.2

Human INSL4(Early placenta insulin-like peptide) ELISA Kit

EH1173 96T
EUR 681.12
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide

20-abx062773
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide

20-abx062774
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide

20-abx161890
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Rat Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E02R0119-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Rat Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E02R0119-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Rat Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E02R0119-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Rat Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E08R0119-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Canine Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E08R0119-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Canine Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E08R0119-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Canine Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E07R0119-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Porcine Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E07R0119-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Porcine Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E07R0119-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Porcine Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody

20-abx218407
  • EUR 510.00
  • EUR 410.40
  • 100 ug
  • 50 ug

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody

20-abx104448
  • EUR 493.20
  • EUR 159.60
  • EUR 1378.80
  • EUR 678.00
  • EUR 376.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody

20-abx104449
  • EUR 493.20
  • EUR 159.60
  • EUR 1378.80
  • EUR 678.00
  • EUR 376.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx174369
  • EUR 1028.40
  • EUR 526.80
  • 1 mg
  • 200 ug

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx178245
  • EUR 1446.00
  • EUR 693.60
  • 1 mg
  • 200 ug

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx212781
  • EUR 493.20
  • EUR 360.00
  • 100 ul
  • 50 ul

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx211855
  • EUR 493.20
  • EUR 360.00
  • 100 ul
  • 50 ul

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx119157
  • EUR 376.80
  • EUR 117.60
  • EUR 477.60
  • EUR 594.00
  • 100 ug
  • 10 ug
  • 200 ug
  • 300 µg

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx321215
  • EUR 526.80
  • EUR 393.60
  • 100 ul
  • 50 ul

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx322026
  • EUR 526.80
  • EUR 393.60
  • 100 ul
  • 50 ul

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx327281
  • EUR 376.80
  • EUR 292.80
  • 100 ug
  • 50 ug

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody

abx030698-400ul 400 ul
EUR 627.6

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody

abx030698-80l 80 µl
EUR 343.2

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

abx030791-400ul 400 ul
EUR 627.6

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

abx030791-80l 80 µl
EUR 343.2

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx126504
  • EUR 493.20
  • EUR 710.40
  • EUR 218.40
  • EUR 376.80
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody

abx122948-100ug 100 ug
EUR 469.2

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody

20-abx328076
  • EUR 376.80
  • EUR 292.80
  • 100 ug
  • 50 ug

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody

20-abx338522
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Goat Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E06R0119-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Goat Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E06R0119-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Goat Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E06R0119-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Goat Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-10ug 10ug
EUR 242.4
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-1mg 1mg
EUR 2739.6
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-500ug 500ug
EUR 1935.6
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-50ug 50ug
EUR 595.2
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Human Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E01R0119-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Human Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E01R0119-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Human Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E01R0119-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Human Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

RXFP1 ELISA Kit| Rat Relaxin/Insulin Like Family Peptide Recepto

EF018019 96 Tests
EUR 826.8

Rabbit Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E04R0119-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Rabbit Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E04R0119-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Rabbit Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E04R0119-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Rabbit Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E09R0119-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Monkey Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E09R0119-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Monkey Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E09R0119-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Monkey Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Recombinant Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1)

4-RPB456Hu01
  • EUR 636.10
  • EUR 294.00
  • EUR 2055.36
  • EUR 765.12
  • EUR 1410.24
  • EUR 501.60
  • EUR 4958.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Relaxin/Insulin Like Family Peptide Receptor 1 expressed in: E.coli

Recombinant Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1)

4-RPB456Hu02
  • EUR 605.99
  • EUR 285.60
  • EUR 1942.46
  • EUR 727.49
  • EUR 1334.98
  • EUR 481.20
  • EUR 4676.16
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Relaxin/Insulin Like Family Peptide Receptor 1 expressed in: E.coli

RR-SRC, Insulin Receptor Tyrosine Kinase Substrate (Biotin) Peptide

20-abx265690
  • EUR 661.20
  • EUR 1111.20
  • EUR 477.60
  • 10 mg
  • 25 mg
  • 5 mg

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody (HRP)

20-abx337465
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody (FITC)

20-abx271099
  • EUR 560.40
  • EUR 292.80
  • EUR 1629.60
  • EUR 777.60
  • EUR 427.20
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody (FITC)

20-abx337466
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Human Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Protein

20-abx654937
  • EUR 693.60
  • EUR 309.60
  • EUR 2064.00
  • EUR 828.00
  • EUR 510.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Rat IRAP (Insulin regulated aminopeptidase) Control/blocking peptide #1

IRAP11-P 100 ug
EUR 196.8

Rat Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit

abx255980-96tests 96 tests
EUR 848.4

Pig Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit

abx361606-96tests 96 tests
EUR 990

Rat RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit

ER1314 96T
EUR 628.92
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Rattus;Sensitivity: 9.375pg/ml

Insulin Like Growth Factor 1 Receptor (IGF1R) (pY1161) Blocking Peptide

20-abx161646
  • EUR 376.80
  • EUR 610.80
  • 1 mg
  • 5 mg

Insulin Like Growth Factor 1 Receptor (IGF1R) (pY1161) Blocking Peptide

20-abx162346
  • EUR 376.80
  • EUR 610.80
  • 1 mg
  • 5 mg

Human Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) CLIA Kit

20-abx494418
  • EUR 9567.60
  • EUR 5095.20
  • EUR 1177.20
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Guinea pig Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E05R0119-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Guinea pig Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E05R0119-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Guinea pig Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E05R0119-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Guinea pig Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody (Biotin)

20-abx271364
  • EUR 526.80
  • EUR 292.80
  • EUR 1513.20
  • EUR 727.20
  • EUR 393.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody (Biotin)

20-abx337467
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Insulin Like Growth Factor Binding Protein 1 (IGFBP1) Blocking Peptide

20-abx061345
  • EUR 343.20
  • EUR 510.00
  • 1 mg
  • 5 mg

Insulin Like Growth Factor Binding Protein 3 (IGFBP3) Blocking Peptide

20-abx061777
  • EUR 309.60
  • EUR 460.80
  • 1 mg
  • 5 mg

Insulin Like Growth Factor Binding Protein 1 (IGFBP1) Blocking Peptide

20-abx161892
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Like Growth Factor Binding Protein 3 (IGFBP3) Blocking Peptide

20-abx162509
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit

abx253121-96tests 96 tests
EUR 848.4

Human Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) ELISA Kit

abx385364-96tests 96 tests
EUR 1093.2

Sheep Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit

abx364728-96tests 96 tests
EUR 1111.2

Human Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) ELISA Kit

DLR-RXFP3-Hu-48T 48T
EUR 620.4
Description: A sandwich quantitative ELISA assay kit for detection of Human Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) in samples from tissue homogenates, cell lysates or other biological fluids.

Human Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) ELISA Kit

DLR-RXFP3-Hu-96T 96T
EUR 807.6
Description: A sandwich quantitative ELISA assay kit for detection of Human Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) in samples from tissue homogenates, cell lysates or other biological fluids.

Human Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) ELISA Kit

20-abx152990
  • EUR 8853.60
  • EUR 4719.60
  • EUR 1093.20
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit

EH3733 96T
EUR 628.92
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 9.375pg/ml

Human Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) ELISA Kit

RD-RXFP3-Hu-48Tests 48 Tests
EUR 625.2

Human Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) ELISA Kit

RD-RXFP3-Hu-96Tests 96 Tests
EUR 867.6

Human Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) ELISA Kit

RDR-RXFP3-Hu-48Tests 48 Tests
EUR 652.8

Mouse Insulin C- peptide