Mouse Insulin C- peptide
Contact us: [email protected]
Mouse Insulin- like peptide INSL6, Insl6 ELISA KIT |
ELI-13429m |
Lifescience Market |
96 Tests |
EUR 1038 |
Human Insulin B Peptide |
abx670051-5mg |
Abbexa |
5 mg |
EUR 427.2 |
|
Mouse Insulin-like peptide INSL5 (INSL5) ELISA Kit |
abx574867-96tests |
Abbexa |
96 tests |
EUR 801.6 |
|
Mouse Insulin-like peptide INSL5(INSL5) ELISA kit |
CSB-EL011749MO-24T |
Cusabio |
1 plate of 24 wells |
EUR 198 |
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Mouse Insulin-like peptide INSL5(INSL5) ELISA kit |
1-CSB-EL011749MO |
Cusabio |
-
EUR 964.80
-
EUR 6118.80
-
EUR 3244.80
|
- 1 plate of 96 wells
- 10 plates of 96 wells each
- 5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Mouse Insulin-like peptide INSL5 (INSL5) ELISA Kit |
RK13149 |
Abclonal |
96T |
EUR 280 |
Mouse Insulin-like peptide INSL5(INSL5) Elisa kit |
EK731135 |
AFG Bioscience LLC |
96 Wells |
EUR 0.75 |
Mouse Insulin-like peptide INSL5(INSL5) ELISA kit |
EKC37110-5x96T |
Biomatik Corporation |
5x96T |
EUR 3637.08 |
Mouse Insulin Like peptide INSL5, INSL5 GENLISA ELISA |
KLM2151 |
Krishgen |
1 x 96 wells |
EUR 341 |
Insulin Blocking Peptide |
20-abx064168 |
Abbexa |
|
|
|
Insulin Blocking Peptide |
20-abx064169 |
Abbexa |
|
|
|
Insulin Blocking Peptide |
AF5109-BP |
Affbiotech |
1mg |
EUR 234 |
ELISA kit for Human Insulin-like peptide INSL5,Insulin-like peptide 5 |
EK2663 |
SAB |
96 tests |
EUR 663.6 |
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Insulin-like peptide INSL5,Insulin-like peptide 5 in samples from serum, plasma, tissue homogenates and other biological fluids. |
Insulin-like peptide INSL6 |
AP84213 |
SAB |
1mg |
EUR 2640 |
|
Insulin-like peptide INSL5 |
AP84306 |
SAB |
1mg |
EUR 2640 |
|
Insulin-like peptide INSL5 |
AP84387 |
SAB |
1mg |
EUR 2640 |
|
Insulin-like peptide INSL6 |
AP84433 |
SAB |
1mg |
EUR 2640 |
|
Insulin-like peptide INSL6 |
AP79811 |
SAB |
1mg |
EUR 2640 |
|
Insulin Receptor (INSR) Peptide |
20-abx266328 |
Abbexa |
-
EUR 594.00
-
EUR 978.00
-
EUR 427.20
|
|
|
Insulin β Chain Peptide (15-23) |
T40132-10mg |
TargetMol Chemicals |
10mg |
Ask for price |
|
Description: Insulin β Chain Peptide (15-23) |
Insulin β Chain Peptide (15-23) |
T40132-1g |
TargetMol Chemicals |
1g |
Ask for price |
|
Description: Insulin β Chain Peptide (15-23) |
Insulin β Chain Peptide (15-23) |
T40132-1mg |
TargetMol Chemicals |
1mg |
Ask for price |
|
Description: Insulin β Chain Peptide (15-23) |
Insulin β Chain Peptide (15-23) |
T40132-50mg |
TargetMol Chemicals |
50mg |
Ask for price |
|
Description: Insulin β Chain Peptide (15-23) |
Insulin β Chain Peptide (15-23) |
T40132-5mg |
TargetMol Chemicals |
5mg |
Ask for price |
|
Description: Insulin β Chain Peptide (15-23) |
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA |
E01A24957 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Insulin Receptor Blocking Peptide |
AF4692-BP |
Affbiotech |
1mg |
EUR 234 |
Insulin Receptor (INSR) Amide Peptide |
20-abx266403 |
Abbexa |
-
EUR 627.60
-
EUR 1045.20
-
EUR 460.80
|
|
|
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit |
E03R0119-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit |
E03R0119-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit |
E03R0119-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
RXFP1 ELISA Kit| Mouse Relaxin/Insulin Like Family Peptide Recep |
EF012910 |
Lifescience Market |
96 Tests |
EUR 826.8 |
Mouse Relaxin/Insulin Like Family Peptide Receptor 3 ELISA kit |
E01A25163 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Mouse Relaxin/Insulin Like Family Peptide Receptor 2 ELISA kit |
E01A25164 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Mouse Relaxin/Insulin Like Family Peptide Receptor 4 ELISA kit |
E01A25165 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS] |
INSB25-P |
Alpha Diagnostics |
500 ug |
EUR 416.4 |
Insulin Receptor (INSR) Blocking Peptide |
20-abx062798 |
Abbexa |
|
|
|
Insulin Receptor (INSR) Blocking Peptide |
20-abx161901 |
Abbexa |
|
|
|
Early placenta insulin-like peptide |
AP84750 |
SAB |
1mg |
EUR 2640 |
|
Goat Anti-Human/mouse/rat Insulin chain A peptide IgG, aff pure |
INSA21-A |
Alpha Diagnostics |
100 ul |
EUR 578.4 |
Insulin Receptor beta Blocking Peptide |
DF6088-BP |
Affbiotech |
1mg |
EUR 234 |
Insulin Receptor (1142-1153) (Biotin) Peptide |
20-abx266416 |
Abbexa |
-
EUR 627.60
-
EUR 1045.20
-
EUR 460.80
|
|
|
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit |
abx254542-96tests |
Abbexa |
96 tests |
EUR 848.4 |
|
Mouse Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) ELISA Kit |
abx390435-96tests |
Abbexa |
96 tests |
EUR 1093.2 |
|
Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit |
EM0166 |
FN Test |
96T |
EUR 628.92 |
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 9.375pg/ml |
Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit |
EKF59220-48T |
Biomatik Corporation |
48T |
EUR 396.9 |
Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit |
EKF59220-5x96T |
Biomatik Corporation |
5x96T |
EUR 2693.25 |
Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit |
EKF59220-96T |
Biomatik Corporation |
96T |
EUR 567 |
Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit |
RE2148M-48wells |
Reed Biotech |
48 wells |
EUR 116.55 |
|
Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit |
RE2148M-96wells |
Reed Biotech |
96 wells |
EUR 161.55 |
|
Monoclonal Anti-Human/mouse/rat Insulin chain B peptide IgG, aff pure |
INSB22-M |
Alpha Diagnostics |
100 ul |
EUR 578.4 |
ELISA kit for Mouse RXFP1 (Relaxin/Insulin Like Family Peptide Receptor 1) |
E-EL-M1010 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 640.8 |
|
Description: A sandwich ELISA kit for quantitative measurement of Mouse RXFP1 (Relaxin/Insulin Like Family Peptide Receptor 1) in samples from Serum, Plasma, Cell supernatant |
Insulin Like Growth Factor 1 (IGF1) Peptide |
20-abx266444 |
Abbexa |
-
EUR 661.20
-
EUR 1111.20
-
EUR 477.60
|
|
|
Insulin Receptor (1142-1153), amide (Biotin) Peptide |
20-abx266464 |
Abbexa |
-
EUR 661.20
-
EUR 1111.20
-
EUR 477.60
|
|
|
Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide |
20-abx068858 |
Abbexa |
-
EUR 844.80
-
EUR 343.20
-
EUR 2614.80
-
EUR 1011.60
-
EUR 610.80
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide |
20-abx068859 |
Abbexa |
-
EUR 878.40
-
EUR 343.20
-
EUR 2766.00
-
EUR 1062.00
-
EUR 627.60
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Kinase Domain of Insulin Receptor (1) Peptide |
20-abx266352 |
Abbexa |
-
EUR 610.80
-
EUR 1028.40
-
EUR 444.00
|
|
|
Kinase Domain of Insulin Receptor (2) Peptide |
20-abx266448 |
Abbexa |
-
EUR 661.20
-
EUR 1111.20
-
EUR 477.60
|
|
|
Human Insulin-Like Peptide INSL5 GENLISA ELISA |
KBH4843 |
Krishgen |
1 x 96 wells |
EUR 286 |
Human Insulin- like peptide INSL6, INSL6 ELISA KIT |
ELI-12379h |
Lifescience Market |
96 Tests |
EUR 988.8 |
Human Insulin- like peptide INSL5, INSL5 ELISA KIT |
ELI-20454h |
Lifescience Market |
96 Tests |
EUR 988.8 |
Bovine Insulin- like peptide INSL6, INSL6 ELISA KIT |
ELI-42113b |
Lifescience Market |
96 Tests |
EUR 1113.6 |
Rxfp2 (untagged) - Mouse relaxin/insulin-like family peptide receptor 2 (Rxfp2), (10ug) |
MC221250 |
Origene Technologies GmbH |
10 µg |
Ask for price |
Rxfp1 (untagged) - Mouse relaxin/insulin-like family peptide receptor 1 (Rxfp1), (10ug) |
MC221411 |
Origene Technologies GmbH |
10 µg |
Ask for price |
Insulin Like Growth Factor 1 (IGF1) (30-41) Peptide |
20-abx266288 |
Abbexa |
-
EUR 594.00
-
EUR 978.00
-
EUR 427.20
|
|
|
Human Insulin-like peptide INSL5 (INSL5) ELISA Kit |
abx570706-96tests |
Abbexa |
96 tests |
EUR 801.6 |
|
Human Insulin-like peptide INSL5(INSL5) ELISA kit |
CSB-EL011749HU-24T |
Cusabio |
1 plate of 24 wells |
EUR 198 |
|
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Human Insulin-like peptide INSL5(INSL5) ELISA kit |
1-CSB-EL011749HU |
Cusabio |
-
EUR 964.80
-
EUR 6118.80
-
EUR 3244.80
|
- 1 plate of 96 wells
- 10 plates of 96 wells each
- 5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Human Insulin-like peptide INSL5 (INSL5) ELISA Kit |
RK10978 |
Abclonal |
96T |
EUR 280 |
Human Insulin-like peptide INSL6 (INSL6) ELISA Kit |
RK11214 |
Abclonal |
96T |
EUR 280 |
Human Insulin-like peptide INSL6 (INSL6) ELISA Kit |
AE58491HU-48Tests |
Abebio |
48 Tests |
EUR 325 |
|
Description: Human (Homo sapiens) |
Human Insulin-like peptide INSL6 (INSL6) ELISA Kit |
AE58491HU-96Tests |
Abebio |
96 Tests |
EUR 610 |
|
Description: Human (Homo sapiens) |
Human Insulin-like peptide INSL5(INSL5) ELISA kit |
EKC42536-5x96T |
Biomatik Corporation |
5x96T |
EUR 3683.15 |
Human Insulin-like peptide INSL6 (INSL6) ELISA Kit |
EK11234 |
SAB |
96Т |
EUR 799 |
|
IGF-I Receptor/Insulin Receptor Blocking Peptide |
AF4697-BP |
Affbiotech |
1mg |
EUR 234 |
Bovine Insulin-like peptide INSL6 (INSL6) ELISA Kit |
AE60752BO-48Tests |
Abebio |
48 Tests |
EUR 360 |
|
Description: Bovine (Bos taurus; Cattle) |
Bovine Insulin-like peptide INSL6 (INSL6) ELISA Kit |
AE60752BO-96Tests |
Abebio |
96 Tests |
EUR 680 |
|
Description: Bovine (Bos taurus; Cattle) |
Bovine Insulin-like peptide INSL6 (INSL6) ELISA Kit |
EK11546 |
SAB |
96Т |
EUR 799 |
|
Insulin Like Growth Factor 1 (IGF1) Analog Peptide |
20-abx266295 |
Abbexa |
-
EUR 594.00
-
EUR 978.00
-
EUR 427.20
|
|
|
Insulin Like Growth Factor 1 (IGF1) (1-3) Peptide |
20-abx265710 |
Abbexa |
-
EUR 393.60
-
EUR 594.00
-
EUR 326.40
|
|
|
Mouse/rat/hamster/Insulin A chain peptide (90-110 aa; Cys-95-Cys100) [GIVDQCCTSICSLYQLENYCN] |
INSA15-P |
Alpha Diagnostics |
500 ug |
EUR 343.2 |
Human Insulin-like peptide 5, ILP-5 ELISA Kit |
SL3753Hu |
Sunlong |
96 Tests |
EUR 468 |
|
Rxfp2 (GFP-tagged) - Mouse relaxin/insulin-like family peptide receptor 2 (Rxfp2), (10ug) |
MG222701 |
Origene Technologies GmbH |
10 µg |
Ask for price |
Rxfp1 (GFP-tagged) - Mouse relaxin/insulin-like family peptide receptor 1 (Rxfp1), (10ug) |
MG223089 |
Origene Technologies GmbH |
10 µg |
Ask for price |
Insulin Receptor (INSR) (Phospho-Y1355) Blocking Peptide |
20-abx161651 |
Abbexa |
|
|
|
Insulin Receptor (INSR) (Phospho-Y1361) Blocking Peptide |
20-abx161652 |
Abbexa |
|
|
|
Kinase Domain of Insulin Receptor (2) (Biotin) Peptide |
20-abx266404 |
Abbexa |
-
EUR 627.60
-
EUR 1045.20
-
EUR 460.80
|
|
|
Insulin Like Growth Factor 1 (IGF1) Blocking Peptide |
20-abx161136 |
Abbexa |
|
|
|
Rxfp1 (Myc-DDK-tagged) - Mouse relaxin/insulin-like family peptide receptor 1 (Rxfp1) |
MR223089 |
Origene Technologies GmbH |
10 µg |
Ask for price |
Rxfp2 (Myc-DDK-tagged) - Mouse relaxin/insulin-like family peptide receptor 2 (Rxfp2) |
MR222701 |
Origene Technologies GmbH |
10 µg |
Ask for price |
ELISA kit for Human Insulin-like peptide INSL6 (INSL6) |
KTE62243-48T |
Abbkine |
48T |
EUR 424.8 |
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Insulin-like peptide INSL6 (INSL6) |
KTE62243-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2702.4 |
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Insulin-like peptide INSL6 (INSL6) |
KTE62243-96T |
Abbkine |
96T |
EUR 686.4 |
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6) |
KTE10416-48T |
Abbkine |
48T |
EUR 424.8 |
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6) |
KTE10416-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2702.4 |
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6) |
KTE10416-96T |
Abbkine |
96T |
EUR 686.4 |
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
Human Early placenta insulin- like peptide, INSL4 ELISA KIT |
ELI-03359h |
Lifescience Market |
96 Tests |
EUR 988.8 |
Rat Relaxin/Insulin Like Family Peptide Receptor 1 ELISA |
E01A16210 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Human Early placenta insulin-like peptide(INSL4) ELISA kit |
CSB-EL011748HU-24T |
Cusabio |
1 plate of 24 wells |
EUR 198 |
|
Description: Quantitativesandwich ELISA kit for measuring Human Early placenta insulin-like peptide (INSL4) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Human Early placenta insulin-like peptide(INSL4) ELISA kit |
1-CSB-EL011748HU |
Cusabio |
-
EUR 964.80
-
EUR 6118.80
-
EUR 3244.80
|
- 1 plate of 96 wells
- 10 plates of 96 wells each
- 5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Human Early placenta insulin-like peptide(INSL4) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Human INSL4/ Early placenta insulin-like peptide ELISA Kit |
E1323Hu |
Sunlong |
1 Kit |
EUR 685.2 |
Human INSL4(Early placenta insulin-like peptide) ELISA Kit |
EH1173 |
FN Test |
96T |
EUR 681.12 |
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml |
Human Early placenta insulin-like peptide (INSL4) ELISA Kit |
RK07548 |
Abclonal |
96T |
EUR 280 |
Human Early placenta insulin-like peptide(INSL4) Elisa Kit |
EK712762 |
AFG Bioscience LLC |
96 Wells |
EUR 0.29 |
Goat Relaxin/Insulin Like Family Peptide Receptor 1 ELISA |
E01A51113 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His) |
C988-10ug |
Novoprotein |
10ug |
EUR 242.4 |
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0. |
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His) |
C988-1mg |
Novoprotein |
1mg |
EUR 2739.6 |
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0. |
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His) |
C988-500ug |
Novoprotein |
500ug |
EUR 1935.6 |
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0. |
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His) |
C988-50ug |
Novoprotein |
50ug |
EUR 595.2 |
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0. |
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His) |
AP75432 |
SAB |
1mg |
EUR 3209 |
|
Human Relaxin/Insulin Like Family Peptide Receptor 1 ELISA |
E01A7465 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Sheep Relaxin/Insulin Like Family Peptide Receptor 1 ELISA |
E01A103407 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Bovine Relaxin/Insulin Like Family Peptide Receptor 1 ELISA |
E01A85980 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Rabbit Relaxin/Insulin Like Family Peptide Receptor 1 ELISA |
E01A33679 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Monkey Relaxin/Insulin Like Family Peptide Receptor 1 ELISA |
E01A77260 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Canine Relaxin/Insulin Like Family Peptide Receptor 1 ELISA |
E01A68541 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide |
20-abx062773 |
Abbexa |
|
|
|
Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide |
20-abx062774 |
Abbexa |
|
|
|
Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide |
20-abx161890 |
Abbexa |
|
|
|
Chicken Relaxin/Insulin Like Family Peptide Receptor 1 ELISA |
E01A94693 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Porcine Relaxin/Insulin Like Family Peptide Receptor 1 ELISA |
E01A59831 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Rxfp2 (untagged) - Mouse relaxin/insulin-like family peptide receptor 2 (Rxfp2), transcript variant 2 |
MC228748 |
Origene Technologies GmbH |
10 µg |
Ask for price |
Rxfp2 (untagged) - Mouse relaxin/insulin-like family peptide receptor 2 (Rxfp2), transcript variant 3 |
MC228788 |
Origene Technologies GmbH |
10 µg |
Ask for price |
Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody |
20-abx218407 |
Abbexa |
|
|
|
Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody |
20-abx104448 |
Abbexa |
-
EUR 493.20
-
EUR 159.60
-
EUR 1378.80
-
EUR 678.00
-
EUR 376.80
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody |
20-abx104449 |
Abbexa |
-
EUR 493.20
-
EUR 159.60
-
EUR 1378.80
-
EUR 678.00
-
EUR 376.80
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody |
20-abx174369 |
Abbexa |
|
|
|
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody |
20-abx178245 |
Abbexa |
|
|
|
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody |
20-abx212781 |
Abbexa |
|
|
|
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody |
20-abx211855 |
Abbexa |
|
|
|
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody |
20-abx119157 |
Abbexa |
-
EUR 376.80
-
EUR 117.60
-
EUR 477.60
-
EUR 594.00
|
- 100 ug
- 10 ug
- 200 ug
- 300 µg
|
|
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody |
20-abx321215 |
Abbexa |
|
|
|
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody |
20-abx322026 |
Abbexa |
|
|
|
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody |
20-abx327281 |
Abbexa |
|
|
|
Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody |
abx030698-400ul |
Abbexa |
400 ul |
EUR 627.6 |
|
Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody |
abx030698-80l |
Abbexa |
80 µl |
EUR 343.2 |
|
Mouse Insulin C- peptide