Mouse Insulin C- peptide

Mouse Insulin C- peptide

Contact us: [email protected]

Canine C-Peptide ELISA Kit

DLR-C-Peptide-c-48T 48T
EUR 527
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit

DLR-C-Peptide-c-96T 96T
EUR 688
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit

RDR-C-Peptide-c-48Tests 48 Tests
EUR 557

Canine C-Peptide ELISA Kit

RDR-C-Peptide-c-96Tests 96 Tests
EUR 774

Mouse C-Peptide ELISA Kit

RD-C-Peptide-Mu-48Tests 48 Tests
EUR 446

Mouse C-Peptide ELISA Kit

RD-C-Peptide-Mu-96Tests 96 Tests
EUR 615

Mouse C-Peptide ELISA Kit

DLR-C-Peptide-Mu-48T 48T
EUR 450
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit

DLR-C-Peptide-Mu-96T 96T
EUR 582
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit

RDR-C-Peptide-Mu-48Tests 48 Tests
EUR 465

Mouse C-Peptide ELISA Kit

RDR-C-Peptide-Mu-96Tests 96 Tests
EUR 643

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-48Tests 48 Tests
EUR 387

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-96Tests 96 Tests
EUR 532

Rat C-Peptide ELISA Kit

RD-C-Peptide-Ra-48Tests 48 Tests
EUR 465

Rat C-Peptide ELISA Kit

RD-C-Peptide-Ra-96Tests 96 Tests
EUR 643

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-48T 48T
EUR 398
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-96T 96T
EUR 511
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit

DLR-C-Peptide-Ra-48T 48T
EUR 467
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit

DLR-C-Peptide-Ra-96T 96T
EUR 605
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-48Tests 48 Tests
EUR 404

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-96Tests 96 Tests
EUR 556

Rat C-Peptide ELISA Kit

RDR-C-Peptide-Ra-48Tests 48 Tests
EUR 486

Rat C-Peptide ELISA Kit

RDR-C-Peptide-Ra-96Tests 96 Tests
EUR 672

Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ]

INSC35-P 500 ug
EUR 347

Insulin Blocking Peptide

20-abx064168
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg

Insulin Blocking Peptide

20-abx064169
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg

Insulin Peptide (OVA)

20-abx165763
  • EUR 523.00
  • EUR 244.00
  • EUR 1497.00
  • EUR 606.00
  • EUR 384.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Insulin Blocking Peptide

AF5109-BP 1mg
EUR 195

Insulin; Clone 2D11-H5 (Concentrate)

A00114-C 1 ml
EUR 437

Recombinant Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein

IGFBP53-C 100 ul
EUR 286

Control/Blocking peptide Mouse BCL-2

BCL21-C 100 ug
EUR 164

Human Insulin B Peptide

abx670051-5mg 5 mg
EUR 356

Insulin Receptor (INSR) Peptide

20-abx266328
  • EUR 495.00
  • EUR 815.00
  • EUR 356.00
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Receptor Blocking Peptide

AF4692-BP 1mg
EUR 195

Control/Blocking peptide for Mouse Vimentin (Vim)

VIM11-C 100 ug
EUR 164

Recombinant Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control

IGFBP33-C 100 ul
EUR 286

ELISA kit for Human Insulin-like peptide INSL5,Insulin-like peptide 5

EK2663 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Insulin-like peptide INSL5,Insulin-like peptide 5 in samples from serum, plasma, tissue homogenates and other biological fluids.

Insulin Receptor (INSR) Blocking Peptide

20-abx062798
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg

Insulin Receptor (INSR) Amide Peptide

20-abx266403
  • EUR 523.00
  • EUR 871.00
  • EUR 384.00
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Receptor (INSR) Blocking Peptide

20-abx161901
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg

Insulin Receptor beta Blocking Peptide

DF6088-BP 1mg
EUR 195

Control/Blocking peptide for Mouse TATA box-binding protein

TATAB11-C 100 ug
EUR 164

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

CSB-EL011749MO-24T 1 plate of 24 wells
EUR 165
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

1-CSB-EL011749MO
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Insulin-like peptide INSL5 (INSL5) ELISA Kit

abx574867-96tests 96 tests
EUR 668

Mouse Insulin- like peptide INSL5, Insl5 ELISA KIT

ELI-43454m 96 Tests
EUR 865

Mouse Insulin- like peptide INSL6, Insl6 ELISA KIT

ELI-13429m 96 Tests
EUR 865

Canine Insulin (INS) ELISA Kit

DLR-INS-c-48T 48T
EUR 624
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine Insulin (INS) ELISA Kit

DLR-INS-c-96T 96T
EUR 821
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine Insulin (INS) ELISA Kit

RDR-INS-c-48Tests 48 Tests
EUR 672

Canine Insulin (INS) ELISA Kit

RDR-INS-c-96Tests 96 Tests
EUR 938

Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB

IGFBP13-C 100 ul
EUR 286

Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB

IGFBP23-C 100 ul
EUR 286

Recombinant (NSO) purified Mouse/Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB

IGFBP63-C 100 ul
EUR 286

Recombinant (Sf21) purified Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB

IGFBP73-C 100 ul
EUR 286

Control/Blocking peptide for Mouse Neurogenic differentation factor 1 (NeuroD1)

NEUD1-C 100 ug
EUR 164

Control/Blocking peptide for Mouse Neuronal migration protein doublecortin (DCX)

DCX11-C 100 ug
EUR 164

Monoclonal Anti-Human Insulin C-peptide IgG, aff pure

INSC23-M 100 ul
EUR 482

Control/Blocking peptide CD40

CD4011-C 100 ug
EUR 164

Control/Blocking peptide EOMES

EMS11-C 100 ug
EUR 164

Insulin Receptor (1142-1153) (Biotin) Peptide

20-abx266416
  • EUR 523.00
  • EUR 871.00
  • EUR 384.00
  • 10 mg
  • 25 mg
  • 5 mg

Phospho-Insulin Receptor (Tyr1355) Blocking Peptide

AF4392-BP 1mg
EUR 195

Mouse C-Peptide/ C-Peptide ELISA Kit

E0316Mo 1 Kit
EUR 571

Mouse C-Peptide(C-Peptide) ELISA Kit

EM0947 96T
EUR 476.25
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 0.094 ng/ml

Insulin C-terminal Antibody

abx021216-1mg 1 mg
EUR 787

Recombinant Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control

IGFBP31-C 100 ul
EUR 286

Control/Blocking peptide Human BCL-2

BCL11-C 100 ug
EUR 164

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate)

RA0164-C.1 0.1 ml
EUR 125

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate)

RA0164-C.5 0.5 ml
EUR 300

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate)

RA0165-C.1 0.1 ml
EUR 125

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate)

RA0165-C.5 0.5 ml
EUR 300

Purified human recomb insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control

IGFBP51-C 100 ul
EUR 286

Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]

INSB25-P 500 ug
EUR 347

RXFP1 ELISA Kit| Mouse Relaxin/Insulin Like Family Peptide Recep

EF012910 96 Tests
EUR 689

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-192T 192 tests
EUR 1270
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-48 1 plate of 48 wells
EUR 520
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-96 1 plate of 96 wells
EUR 685
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Control/Blocking peptide for Mouse Microtubule-associated proteins 1A/1B light chain 3B (anti-Map1lc3b)

MAP13B-C 100 ug
EUR 164

Control/Blocking peptide for Ephrin-B2 antibody

NIVE2B-C 100 ug
EUR 164

Beta catenin 1 (CTNNB1) Control/Blocking Peptide

BCTN11-C 100 ug
EUR 164

Rabbit anti-Lamin B1 Control/Blocking Peptide

BL11-C 100 ug
EUR 164

Kinase Domain of Insulin Receptor (1) Peptide

20-abx266352
  • EUR 509.00
  • EUR 857.00
  • EUR 370.00
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Like Growth Factor 1 (IGF1) Peptide

20-abx266444
  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg

Kinase Domain of Insulin Receptor (2) Peptide

20-abx266448
  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Receptor (1142-1153), amide (Biotin) Peptide

20-abx266464
  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Receptor (INSR) (Phospho-Y1355) Blocking Peptide

20-abx161651
  • EUR 314.00
  • EUR 509.00
  • 1 mg
  • 5 mg

Insulin Receptor (INSR) (Phospho-Y1361) Blocking Peptide

20-abx161652
  • EUR 314.00
  • EUR 509.00
  • 1 mg
  • 5 mg

IGF-I Receptor/Insulin Receptor Blocking Peptide

AF4697-BP 1mg
EUR 195

Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB

IGFBP11-C 100 ul
EUR 286

Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB

IGFBP22-C 100 ul
EUR 286

Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein control for WB

IGFBP41-C 100 ul
EUR 286

Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB

IGFBP62-C 100 ul
EUR 286

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-10ug 10ug
EUR 202
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-1mg 1mg
EUR 2283
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-500ug 500ug
EUR 1613
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-50ug 50ug
EUR 496
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Custom Peptide Synthesis (crude and desalted; mg-kg size, price based upon peptide size: 2-100 aa)

PEP-C 1 Ask for price

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide

20-abx068858
  • EUR 704.00
  • EUR 286.00
  • EUR 2179.00
  • EUR 843.00
  • EUR 509.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide

20-abx068859
  • EUR 732.00
  • EUR 286.00
  • EUR 2305.00
  • EUR 885.00
  • EUR 523.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone 2D11-H5 (INS05) (Concentrate)

RA0161-C.1 0.1 ml
EUR 125

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone 2D11-H5 (INS05) (Concentrate)

RA0161-C.5 0.5 ml
EUR 300

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone E2-E3 (INS04) (Concentrate)

RA0162-C.1 0.1 ml
EUR 125

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone E2-E3 (INS04) (Concentrate)

RA0162-C.5 0.5 ml
EUR 300

Recombinant (E. coli) purified Human Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB

IGFBP72-C 100 ul
EUR 286

Mouse Insulin-1 (Ins1)

1-CSB-YP355623MO
  • EUR 586.00
  • EUR 299.00
  • EUR 2172.00
  • EUR 900.00
  • EUR 1442.00
  • EUR 382.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Mouse Insulin-1(Ins1) expressed in Yeast

Mouse Insulin-1 (Ins1)

1-CSB-EP355623MO
  • EUR 611.00
  • EUR 309.00
  • EUR 1827.00
  • EUR 939.00
  • EUR 1218.00
  • EUR 397.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Mouse Insulin-1(Ins1) expressed in E.coli

Mouse Insulin ELISA Kit

DEIA1166 96T
EUR 1460
Description: The Mouse Ins ELISA kit is designed to detect and quantify the level of Mouse Ins in cell culture supernatant, serum, plasma and tissue. This kit is for research use only and not intended for diagnostic purposes.

Mouse Insulin (INS) Protein

20-abx067219
  • EUR 648.00
  • EUR 272.00
  • EUR 1998.00
  • EUR 773.00
  • EUR 467.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Mouse Insulin ELISA kit

E03I0004-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Mouse Insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Insulin ELISA kit

E03I0004-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Mouse Insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Insulin ELISA kit

E03I0004-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Mouse Insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Insulin (Mouse) ELISA Kit

K4271-100
EUR 805

Control/Blocking peptide Glutamate receptor ionotropic (NMDA/GRN1)

NMDA11-C 100 ug
EUR 164

C-Peptide ELISA Kit| Mouse C-Peptide ELISA Kit

EF013534 96 Tests
EUR 689

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit

RD-IGF1-c-48Tests 48 Tests
EUR 472

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit

RD-IGF1-c-96Tests 96 Tests
EUR 653

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit

DLR-IGF1-c-48T 48T
EUR 474
Description: A sandwich quantitative ELISA assay kit for detection of Canine Insulin Like Growth Factor 1 (IGF1) in samples from serum, plasma or other biological fluids.

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit

DLR-IGF1-c-96T 96T
EUR 614
Description: A sandwich quantitative ELISA assay kit for detection of Canine Insulin Like Growth Factor 1 (IGF1) in samples from serum, plasma or other biological fluids.

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit

RDR-IGF1-c-48Tests 48 Tests
EUR 493

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit

RDR-IGF1-c-96Tests 96 Tests
EUR 683

Insulin

RA20056 100 ul
EUR 370

Mouse Connecting Peptide (C-Peptide) ELISA Kit

abx576327-96tests 96 tests
EUR 668

Mouse Connecting Peptide (C-Peptide) ELISA Kit

abx051521-96tests 96 tests
EUR 754

Mouse C-Type Natriuretic Peptide (NPPC) Peptide

20-abx066174
  • EUR 676.00
  • EUR 286.00
  • EUR 2082.00
  • EUR 801.00
  • EUR 481.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Mouse C-Type Natriuretic Peptide (NPPC) Peptide

20-abx066178
  • EUR 676.00
  • EUR 286.00
  • EUR 2082.00
  • EUR 801.00
  • EUR 481.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Mouse Connecting Peptide (C-Peptide) ELISA Kit

abx255287-96tests 96 tests
EUR 668

Mouse Connecting Peptide (C-Peptide) ELISA Kit

20-abx156702
  • EUR 6642.00
  • EUR 3542.00
  • EUR 825.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Mouse C- Peptide, connecting peptide ELISA Kit

CELI-66099m 96 Tests
EUR 865

Recombinant (NS0) purified Mouse C-Reactive Protein (CRP) cotnrol for Western

CRP21-C 100 ul
EUR 286

Recombinant (NS0) purified Mouse C-Reactive Protein (CRP) cotnrol for Western

CRP24-C 100 ul
EUR 286

Mouse Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) ELISA Kit

abx390435-96tests 96 tests
EUR 911

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit

abx254542-96tests 96 tests
EUR 707

Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit

EM0166 96T
EUR 524.1
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 9.375pg/ml

Human Insulin-like peptide INSL5(INSL5) ELISA kit

CSB-EL011749HU-24T 1 plate of 24 wells
EUR 165
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Insulin-like peptide INSL5(INSL5) ELISA kit

1-CSB-EL011749HU
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human Insulin-like peptide INSL5 (INSL5) ELISA Kit

abx570706-96tests 96 tests
EUR 668

Insulin Like Growth Factor 1 (IGF1) Analog Peptide

20-abx266295
  • EUR 495.00
  • EUR 815.00
  • EUR 356.00
  • 10 mg
  • 25 mg
  • 5 mg

Kinase Domain of Insulin Receptor (2) (Biotin) Peptide

20-abx266404
  • EUR 523.00
  • EUR 871.00
  • EUR 384.00
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Like Growth Factor 1 (IGF1) Blocking Peptide

20-abx161136
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg

Bovine Insulin- like peptide INSL6, INSL6 ELISA KIT

ELI-42113b 96 Tests
EUR 928

Human Insulin- like peptide INSL5, INSL5 ELISA KIT

ELI-20454h 96 Tests
EUR 824

Mouse Insulin C- peptide