Mouse Insulin C- peptide

Mouse Insulin C- peptide

Contact us: [email protected]

Insulin-1 C-Peptide (Mouse)

035-53 100 μg
EUR 214.92

Drosophila Insulin-Like Peptide 8 (DILP 8)

035-79 100 μg
EUR 604.8

Drosophila Insulin-Like Peptide 3 (DILP 3)

035-97 100 μg
EUR 537.84

Drosophila Insulin-Like Peptide 6 (DILP 6)

035-98 100 μg
EUR 537.84

Insulin-1 C-Peptide (Mouse) - Antibody

H-035-53 100 μl
EUR 399.6

Drosophila Insulin-Like Peptide 5 (DILP 5), DB Variant

035-96 100 μg
EUR 537.84

Insulin-1 C-Peptide (Mouse) - Purified IgG Antibody

G-035-53 100 μg
EUR 399.6

Drosophila Insulin-Like Peptide 2 (DILP 2) (Drosophila melanogaster)

036-17 100 μg
EUR 572.4

Drosophila Insulin-Like Peptide 1 (DILP 1) (Drosophila melanogaster)

036-18 100 μg
EUR 572.4

Drosophila Insulin-Like Peptide 4 (DILP 4) (Drosophila melanogaster)

036-19 100 μg
EUR 509.76

Drosophila Insulin-Like Peptide 7 (DILP 7) (Drosophila melanogaster)

036-70 100 μg
EUR 700.92

Drosophila Insulin-Like Peptide 3 (DILP 3) (A29/B25) (Drosophila melanogaster)

036-71 100 μg
EUR 572.4

Insulin-2 C-Peptide (Rat)

035-65 100 μg
EUR 214.92

Insulin 1 (Rat, Mouse)

035-94 20 μg
EUR 423.36

Insulin B:12-20 (Human, Rat, Mouse)

036-12 500 μg
EUR 126.36

Insulin B:13-21 (Human, Rat, Mouse)

036-13 500 μg
EUR 118.8

Insulin B:9-23 (Human, Rat, Mouse)

036-11 500 μg
EUR 118.8

Insulin 1 A-Chain (Rat, Mouse)

035-90 100 μg
EUR 316.44

Insulin 1 B-Chain (Rat, Mouse)

035-93 100 μg
EUR 316.44

Mouse Insulin-like peptide INSL5 ELISA Kit

MBS2888184-10x96StripWells 10x96-Strip-Wells
EUR 4080

Mouse Insulin-like peptide INSL5 ELISA Kit

MBS2888184-48StripWells 48-Strip-Wells
EUR 390

Mouse Insulin-like peptide INSL5 ELISA Kit

MBS2888184-5x96StripWells 5x96-Strip-Wells
EUR 2220

Mouse Insulin-like peptide INSL5 ELISA Kit

MBS2888184-96StripWells 96-Strip-Wells
EUR 520

LIRP (68-130) / C-peptide of locust insulin-related protein

036-49 100 μg
EUR 461.16

Mouse Insulin- like peptide INSL5, Insl5 ELISA KIT

ELI-43454m 96tests
EUR 736

Mouse Insulin- like peptide INSL6, Insl6 ELISA KIT

ELI-13429m 96tests
EUR 736

Insulin-like 6, C-Peptide, Prepro (Insulin-like Peptide 6, Insulin-like Peptide INSL6, INSL6, Relaxin/insulin-like Factor 1, RIF1)

MBS6012518-01mL 0.1(mL
EUR 800

Insulin-like 6, C-Peptide, Prepro (Insulin-like Peptide 6, Insulin-like Peptide INSL6, INSL6, Relaxin/insulin-like Factor 1, RIF1)

MBS6012518-5x01mL 5x0.1mL
EUR 3455

Insulin-like 6, C-Peptide, Prepro (Insulin-like Peptide 6, Insulin-like Peptide INSL6, INSL6, Relaxin/insulin-like Factor 1, RIF1)

MBS641564-01mL 0.1mL
EUR 720

Insulin-like 6, C-Peptide, Prepro (Insulin-like Peptide 6, Insulin-like Peptide INSL6, INSL6, Relaxin/insulin-like Factor 1, RIF1)

MBS641564-5x01mL 5x0.1mL
EUR 3080

Insulin-like 6, C-Peptide, Prepro (Insulin-like Peptide 6, Insulin-like Peptide INSL6, INSL6, Relaxin/insulin-like Factor 1, RIF1)

MBS6009384-01mg 0.1(mg
EUR 800

Insulin-like 6, C-Peptide, Prepro (Insulin-like Peptide 6, Insulin-like Peptide INSL6, INSL6, Relaxin/insulin-like Factor 1, RIF1)

MBS6009384-5x01mg 5x0.1mg
EUR 3455

Insulin-like 6, C-Peptide, Prepro (Insulin-like Peptide 6, Insulin-like Peptide INSL6, INSL6, Relaxin/insulin-like Factor 1, RIF1)

MBS6008937-01mg 0.1(mg
EUR 720

Insulin-like 6, C-Peptide, Prepro (Insulin-like Peptide 6, Insulin-like Peptide INSL6, INSL6, Relaxin/insulin-like Factor 1, RIF1)

MBS6008937-5x01mg 5x0.1mg
EUR 3080

Recombinant Mouse Insulin-like peptide INSL5 (Insl5)

MBS7102428-002mgBaculovirus 0.02mg(Baculovirus)
EUR 950

Recombinant Mouse Insulin-like peptide INSL5 (Insl5)

MBS7102428-002mgEColi 0.02mg(E-Coli)
EUR 505

Recombinant Mouse Insulin-like peptide INSL5 (Insl5)

MBS7102428-002mgYeast 0.02mg(Yeast)
EUR 705

Recombinant Mouse Insulin-like peptide INSL5 (Insl5)

MBS7102428-01mgEColi 0.1mg(E-Coli)
EUR 595

Recombinant Mouse Insulin-like peptide INSL5 (Insl5)

MBS7102428-01mgYeast 0.1mg(Yeast)
EUR 820

Recombinant Mouse Insulin-like peptide INSL6 (Insl6)

MBS1332533-002mgBaculovirus 0.02mg(Baculovirus)
EUR 1090

Recombinant Mouse Insulin-like peptide INSL6 (Insl6)

MBS1332533-002mgEColi 0.02mg(E-Coli)
EUR 680

Recombinant Mouse Insulin-like peptide INSL6 (Insl6)

MBS1332533-002mgYeast 0.02mg(Yeast)
EUR 845

Recombinant Mouse Insulin-like peptide INSL6 (Insl6)

MBS1332533-01mgEColi 0.1mg(E-Coli)
EUR 795

Recombinant Mouse Insulin-like peptide INSL6 (Insl6)

MBS1332533-01mgYeast 0.1mg(Yeast)
EUR 985

Mouse Insulin-like peptide INSL5 (INSL5) ELISA Kit

abx574867-96tests 96 tests
EUR 801.6

Mouse Insulin-like peptide INSL5(INSL5) Elisa kit

EK731135 96 Wells
EUR 0.75

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

EKC37110-48T 48T
EUR 535.99

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

EKC37110-5x96T 5x96T
EUR 3637.08

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

EKC37110-96T 96T
EUR 765.7

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

CSB-EL011749MO-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

1-CSB-EL011749MO
  • Ask for price
  • Ask for price
  • Ask for price
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Insulin-like peptide INSL5,INSL5 ELISA KIT

E2151Mo-1096T 10*96T
EUR 4122

Mouse Insulin-like peptide INSL5,INSL5 ELISA KIT

E2151Mo-48wells 48 wells
EUR 300

Mouse Insulin-like peptide INSL5,INSL5 ELISA KIT

E2151Mo-596T 5*96T
EUR 2061

Mouse Insulin-like peptide INSL5,INSL5 ELISA KIT

E2151Mo-96wells 96 wells
EUR 458

Mouse Insulin-like peptide INSL5 (INSL5) ELISA Kit

RK13149 96T
EUR 280

Mouse Insulin-like peptide INSL5, INSL5 ELISA Kit

MBS706319-10x96StripWells 10x96-Strip-Wells
EUR 5575

Mouse Insulin-like peptide INSL5, INSL5 ELISA Kit

MBS706319-24StripWellsLIMIT1 24-Strip-Wells(LIMIT1)
EUR 275

Mouse Insulin-like peptide INSL5, INSL5 ELISA Kit

MBS706319-48StripWells 48-Strip-Wells
EUR 545

Mouse Insulin-like peptide INSL5, INSL5 ELISA Kit

MBS706319-5x96StripWells 5x96-Strip-Wells
EUR 2920

Mouse Insulin-like peptide INSL5, INSL5 ELISA Kit

MBS706319-96StripWells 96-Strip-Wells
EUR 765

Mouse Insulin-like peptide INSL6, INSL6 ELISA Kit

MBS9329325-10x96StripWells 10x96-Strip-Wells
EUR 6725

Mouse Insulin-like peptide INSL6, INSL6 ELISA Kit

MBS9329325-48StripWells 48-Strip-Wells
EUR 550

Mouse Insulin-like peptide INSL6, INSL6 ELISA Kit

MBS9329325-5x96StripWells 5x96-Strip-Wells
EUR 3420

Mouse Insulin-like peptide INSL6, INSL6 ELISA Kit

MBS9329325-96StripWells 96-Strip-Wells
EUR 765

Mouse Insulin-like peptide INSL5, INSL5 ELISA Kit

MBS1605083-10x96StripWells 10x96-Strip-Wells
EUR 3955

Mouse Insulin-like peptide INSL5, INSL5 ELISA Kit

MBS1605083-48StripWells 48-Strip-Wells
EUR 305

Mouse Insulin-like peptide INSL5, INSL5 ELISA Kit

MBS1605083-5x96StripWells 5x96-Strip-Wells
EUR 2005

Mouse Insulin-like peptide INSL5, INSL5 ELISA Kit

MBS1605083-96StripWells 96-Strip-Wells
EUR 475

Mouse Insl5 / Insulin-like peptide INSL5 ELISA Kit

E10576m 96T
EUR 776

Mouse Insl6 / Insulin-like peptide INSL6 ELISA Kit

E10577m 96T
EUR 776

Mouse INSL6/Insulin-Like Peptide INSL6 ELISA Kit

MBS2889841-10x96StripWells 10x96-Strip-Wells
EUR 4080

Mouse INSL6/Insulin-Like Peptide INSL6 ELISA Kit

MBS2889841-48StripWells 48-Strip-Wells
EUR 390

Mouse INSL6/Insulin-Like Peptide INSL6 ELISA Kit

MBS2889841-5x96StripWells 5x96-Strip-Wells
EUR 2220

Mouse INSL6/Insulin-Like Peptide INSL6 ELISA Kit

MBS2889841-96StripWells 96-Strip-Wells
EUR 520

Mouse Insulin Like peptide INSL5, INSL5 GENLISA ELISA

KLM2151 1 x 96 wells
EUR 341

Insulin Peptide (OVA)

20-abx165763
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Insulin-like peptide INSL5,Insulin-like peptide 5

EK2663 96 tests
EUR 599

Human Insulin-like peptide INSL5, Insulin-like peptide 5

MBS9426500-5x96Tests 5x96Tests
EUR 2820

Human Insulin-like peptide INSL5, Insulin-like peptide 5

MBS9426500-96Tests 96Tests
EUR 615

Insulin (Human)

035-06 20 μg
EUR 81

Human Insulin B Peptide

abx670051-5mg 5 mg
EUR 427.2

Insulin B (9-23) Peptide

abx266655-1ml 1 ml
EUR 375

Insulin B (9-23) Peptide

abx266655-200l 200 µl
EUR 200

Insulin Blocking Peptide

20-abx064168
  • Ask for price
  • Ask for price
  • 1 mg
  • 5 mg

Insulin Blocking Peptide

20-abx064169
  • Ask for price
  • Ask for price
  • 1 mg
  • 5 mg

Insulin Blocking Peptide

AF5109-BP 1mg
EUR 234

Insulin Blocking Peptide

MBS824134-1mg 1mg
EUR 190

Insulin Blocking Peptide

MBS824134-5mg 5mg
EUR 345

Insulin Blocking Peptide

MBS824134-5x5mg 5x5mg
EUR 1465

Insulin Blocking Peptide

MBS822648-1mg 1mg
EUR 190

Insulin Blocking Peptide

MBS822648-5mg 5mg
EUR 345

Insulin Blocking Peptide

MBS822648-5x5mg 5x5mg
EUR 1465

Insulin Blocking Peptide

MBS8309323-1mg 1mg
EUR 190

Insulin Blocking Peptide

MBS8309323-5mg 5mg
EUR 345

Insulin Blocking Peptide

MBS8309323-5x5mg 5x5mg
EUR 1465

Insulin Receptor Peptide

MBS543864-025mg 0.25mg
EUR 280

Insulin Receptor Peptide

MBS543864-5x025mg 5x0.25mg
EUR 1110

Insulin Receptor Peptide

MBS543865-025mg 0.25mg
EUR 280

Insulin Receptor Peptide

MBS543865-5x025mg 5x0.25mg
EUR 1110

Insulin Blocking Peptide

MBS9616814-1mg 1mg
EUR 380

Insulin Blocking Peptide

MBS9616814-5x1mg 5x1mg
EUR 1650

Insulin Blocking Peptide

MBS9626185-1mg 1mg
EUR 380

Insulin Blocking Peptide

MBS9626185-5x1mg 5x1mg
EUR 1650

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA

E01A24957 96T
EUR 700
Description: ELISA

Insulin (Human) - Antibody

H-035-06GP 50 μl
EUR 238.68

Insulin, KR extended on A-Chain C-terminus (Human)

035-89 100 μg
EUR 405

Mouse Relaxin/Insulin Like Family Peptide Receptor 3 ELISA kit

E01A25163 96T
EUR 700
Description: ELISA

Mouse Relaxin/Insulin Like Family Peptide Receptor 2 ELISA kit

E01A25164 96T
EUR 700
Description: ELISA

Mouse Relaxin/Insulin Like Family Peptide Receptor 4 ELISA kit

E01A25165 96T
EUR 700
Description: ELISA

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA Kit

MBS046690-10x96StripWells 10x96-Strip-Wells
EUR 6725

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA Kit

MBS046690-48StripWells 48-Strip-Wells
EUR 550

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA Kit

MBS046690-5x96StripWells 5x96-Strip-Wells
EUR 3420

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA Kit

MBS046690-96StripWells 96-Strip-Wells
EUR 765

Mouse Relaxin/Insulin Like Family Peptide Receptor 3 ELISA Kit

MBS083328-10x96StripWells 10x96-Strip-Wells
EUR 6725

Mouse Relaxin/Insulin Like Family Peptide Receptor 3 ELISA Kit

MBS083328-48StripWells 48-Strip-Wells
EUR 550

Mouse Relaxin/Insulin Like Family Peptide Receptor 3 ELISA Kit

MBS083328-5x96StripWells 5x96-Strip-Wells
EUR 3420

Mouse Relaxin/Insulin Like Family Peptide Receptor 3 ELISA Kit

MBS083328-96StripWells 96-Strip-Wells
EUR 765

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA Kit

MBS725824-10x96StripWells 10x96-Strip-Wells
EUR 5685

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA Kit

MBS725824-48StripWells 48-Strip-Wells
EUR 485

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA Kit

MBS725824-5x96StripWells 5x96-Strip-Wells
EUR 3020

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA Kit

MBS725824-96StripWells 96-Strip-Wells
EUR 690

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA Kit

MBS761067-10x96StripWells 10x96-Strip-Wells
EUR 3900

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA Kit

MBS761067-48StripWells 48-Strip-Wells
EUR 340

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA Kit

MBS761067-5x96StripWells 5x96-Strip-Wells
EUR 2045

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA Kit

MBS761067-96StripWells 96-Strip-Wells
EUR 455

Insulin (Human) - ELISA Kit

EK-035-06 96 wells
EUR 603.72

Insulin-like peptide INSL6

AP79811 1mg
EUR 2640

Insulin-like peptide INSL6

AP84213 1mg
EUR 2640

Insulin-like peptide INSL5

AP84306 1mg
EUR 2640

Insulin-like peptide INSL5

AP84387 1mg
EUR 2640

Insulin-like peptide INSL6

AP84433 1mg
EUR 2640

Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]

INSB25-P 500 ug
EUR 416.4

Insulin (Human) - Cy3 Labeled

FC3-035-06 1 nmol
EUR 756

Insulin (Human) - Cy5 Labeled

FC5-035-06 1 nmol
EUR 756

Insulin (Human) - FAM Labeled

FG-035-06A 1 nmol
EUR 666.36

Insulin Receptor (INSR) Peptide

20-abx266328
  • Ask for price
  • Ask for price
  • Ask for price
  • 10 mg
  • 25 mg
  • 5 mg

Mouse Insulin C- peptide