Mouse Insulin C- peptide

Contact us: [email protected]

Human Rho guanine nucleotide exchange factor 7 (ARHGEF7)
1-CSB-RP014454h(C)	Cusabio	EUR 456.00 EUR 256.80 EUR 1570.80 EUR 672.00 EUR 1047.60 EUR 314.40	100ug 10ug 1MG 200ug 500ug 50ug
Description: Recombinant Human Rho guanine nucleotide exchange factor 7(ARHGEF7) ,partial expressed in E.coli

Human Neural cell adhesion molecule L1 protein (L1CAM)
1-CSB-RP074394h(C)	Cusabio	EUR 456.00 EUR 256.80 EUR 1570.80 EUR 672.00 EUR 1047.60 EUR 314.40	100ug 10ug 1MG 200ug 500ug 50ug
Description: Recombinant Human Neural cell adhesion molecule L1 protein(L1CAM),partial expressed in E.coli

Human Nuclear pore membrane glycoprotein 210 (NUP210)
1-CSB-EP016195HU(C)	Cusabio	EUR 456.00 EUR 256.80 EUR 1570.80 EUR 672.00 EUR 1047.60 EUR 314.40	100ug 10ug 1MG 200ug 500ug 50ug
Description: Recombinant Human Nuclear pore membrane glycoprotein 210(NUP210),partial expressed in E.coli

Human Tenascin (TNC)
1-CSB-RP115094h(C)	Cusabio	EUR 456.00 EUR 256.80 EUR 1570.80 EUR 672.00 EUR 1047.60 EUR 314.40	100ug 10ug 1MG 200ug 500ug 50ug
Description: Recombinant Human Tenascin(TNC),partial expressed in E.coli

Human Antigen KI-67 (MKI67)
1-CSB-RP116174h(c)	Cusabio	EUR 456.00 EUR 256.80 EUR 1570.80 EUR 672.00 EUR 1047.60 EUR 314.40	100ug 10ug 1MG 200ug 500ug 50ug
Description: Recombinant Human Antigen KI-67(MKI67) ,partial expressed in E.coli

Human Laminin subunit beta-2 (LAMB2)
1-CSB-RP142794h(c)	Cusabio	EUR 456.00 EUR 256.80 EUR 1570.80 EUR 672.00 EUR 1047.60 EUR 314.40	100ug 10ug 1MG 200ug 500ug 50ug
Description: Recombinant Human Laminin subunit beta-2(LAMB2),partial expressed in E.coli

Helicobacter pylori Vacuolating cytotoxin autotransporter (vacA)
1-CSB-RP143794Ba(C)	Cusabio	EUR 733.20 EUR 370.80 EUR 2192.40 EUR 1126.80 EUR 1461.60 EUR 476.40	100ug 10ug 1MG 200ug 500ug 50ug
Description: Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial expressed in E.coli

Human Glutamyl aminopeptidase (ENPEP)
1-CSB-RP147594h(c)	Cusabio	EUR 456.00 EUR 256.80 EUR 1570.80 EUR 672.00 EUR 1047.60 EUR 314.40	100ug 10ug 1MG 200ug 500ug 50ug
Description: Recombinant Human Glutamyl aminopeptidase(ENPEP),partial expressed in E.coli

Saccharomyces cerevisiae Trehalose-phosphatase (TPS2)
1-CSB-RP165694Ye(c)	Cusabio	EUR 733.20 EUR 370.80 EUR 2192.40 EUR 1126.80 EUR 1461.60 EUR 476.40	100ug 10ug 1MG 200ug 500ug 50ug
Description: Recombinant Saccharomyces cerevisiae Trehalose-phosphatase(TPS2),partial expressed in E.coli

Human Histone deacetylase 7 (HDAC7)
1-CSB-RP178994h(C)	Cusabio	EUR 456.00 EUR 256.80 EUR 1570.80 EUR 672.00 EUR 1047.60 EUR 314.40	100ug 10ug 1MG 200ug 500ug 50ug
Description: Recombinant Human Histone deacetylase 7(HDAC7),partial expressed in E.coli

Human Telomerase protein component 1 (TEP1)
1-CSB-RP180494h(c)	Cusabio	EUR 456.00 EUR 256.80 EUR 1570.80 EUR 672.00 EUR 1047.60 EUR 314.40	100ug 10ug 1MG 200ug 500ug 50ug
Description: Recombinant Human Telomerase protein component 1(TEP1),partial expressed in E.coli

Human Collagen alpha-1 (XVII) chain (COL17A1)
1-CSB-RP180994h(c)	Cusabio	EUR 456.00 EUR 256.80 EUR 1570.80 EUR 672.00 EUR 1047.60 EUR 314.40	100ug 10ug 1MG 200ug 500ug 50ug
Description: Recombinant Human Collagen alpha-1(XVII) chain(COL17A1),partial expressed in E.coli

Saccharomyces cerevisiae Neutral trehalase (NTH1)
1-CSB-RP181594Ye(c)	Cusabio	EUR 733.20 EUR 370.80 EUR 2192.40 EUR 1126.80 EUR 1461.60 EUR 476.40	100ug 10ug 1MG 200ug 500ug 50ug
Description: Recombinant Saccharomyces cerevisiae Neutral trehalase(NTH1),partial expressed in E.coli

Mouse C-Peptide ELISA Kit
DLR-C-Peptide-Mu-48T	DL Develop	48T	EUR 540
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit
DLR-C-Peptide-Mu-96T	DL Develop	96T	EUR 698.4
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit
RD-C-Peptide-Mu-48Tests	Reddot Biotech	48 Tests	EUR 535.2

Mouse C-Peptide ELISA Kit
RD-C-Peptide-Mu-96Tests	Reddot Biotech	96 Tests	EUR 738

Mouse C-Peptide ELISA Kit
RDR-C-Peptide-Mu-48Tests	Reddot Biotech	48 Tests	EUR 558

Mouse C-Peptide ELISA Kit
RDR-C-Peptide-Mu-96Tests	Reddot Biotech	96 Tests	EUR 771.6

Canine C-Peptide ELISA Kit
DLR-C-Peptide-c-48T	DL Develop	48T	EUR 632.4
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit
DLR-C-Peptide-c-96T	DL Develop	96T	EUR 825.6
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit
RD-C-Peptide-c-48Tests	Reddot Biotech	48 Tests	EUR 639.6

Canine C-Peptide ELISA Kit
RD-C-Peptide-c-96Tests	Reddot Biotech	96 Tests	EUR 888

Canine C-Peptide ELISA Kit
RDR-C-Peptide-c-48Tests	Reddot Biotech	48 Tests	EUR 668.4

Canine C-Peptide ELISA Kit
RDR-C-Peptide-c-96Tests	Reddot Biotech	96 Tests	EUR 928.8

Human C-Peptide ELISA Kit
DLR-C-Peptide-Hu-48T	DL Develop	48T	EUR 477.6
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit
DLR-C-Peptide-Hu-96T	DL Develop	96T	EUR 613.2
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit
DLR-C-Peptide-Ra-48T	DL Develop	48T	EUR 560.4
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit
DLR-C-Peptide-Ra-96T	DL Develop	96T	EUR 726
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit
RD-C-Peptide-Hu-48Tests	Reddot Biotech	48 Tests	EUR 464.4

Human C-Peptide ELISA Kit
RD-C-Peptide-Hu-96Tests	Reddot Biotech	96 Tests	EUR 638.4

Rat C-Peptide ELISA Kit
RD-C-Peptide-Ra-48Tests	Reddot Biotech	48 Tests	EUR 558

Rat C-Peptide ELISA Kit
RD-C-Peptide-Ra-96Tests	Reddot Biotech	96 Tests	EUR 771.6

Human C-Peptide ELISA Kit
RDR-C-Peptide-Hu-48Tests	Reddot Biotech	48 Tests	EUR 484.8

Human C-Peptide ELISA Kit
RDR-C-Peptide-Hu-96Tests	Reddot Biotech	96 Tests	EUR 667.2

Rat C-Peptide ELISA Kit
RDR-C-Peptide-Ra-48Tests	Reddot Biotech	48 Tests	EUR 583.2

Rat C-Peptide ELISA Kit
RDR-C-Peptide-Ra-96Tests	Reddot Biotech	96 Tests	EUR 806.4

Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ]
INSC35-P	Alpha Diagnostics	500 ug	EUR 416.4

Insulin Peptide (OVA)
20-abx165763	Abbexa	EUR 627.60 EUR 292.80 EUR 1796.40 EUR 727.20 EUR 460.80	100 ug 10 ug 1 mg 200 ug 50 ug

Insulin Blocking Peptide
20-abx064168	Abbexa	EUR 326.40 EUR 493.20	1 mg 5 mg

Insulin Blocking Peptide
20-abx064169	Abbexa	EUR 326.40 EUR 493.20	1 mg 5 mg

Insulin Blocking Peptide
AF5109-BP	Affbiotech	1mg	EUR 234

Insulin; Clone 2D11-H5 (Concentrate)
A00114-C	ScyTek Laboratories	1 ml	EUR 524.4

Insulin Receptor (INSR) Peptide
20-abx266328	Abbexa	EUR 594.00 EUR 978.00 EUR 427.20	10 mg 25 mg 5 mg

Human Insulin B Peptide
abx670051-5mg	Abbexa	5 mg	EUR 427.2

Insulin Receptor Blocking Peptide
AF4692-BP	Affbiotech	1mg	EUR 234

Control/Blocking peptide Mouse BCL-2
BCL21-C	Alpha Diagnostics	100 ug	EUR 196.8

Control/Blocking peptide for Mouse Vimentin (Vim)
VIM11-C	Alpha Diagnostics	100 ug	EUR 196.8

Recombinant Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein
IGFBP53-C	Alpha Diagnostics	100 ul	EUR 343.2

ELISA kit for Human Insulin-like peptide INSL5,Insulin-like peptide 5
EK2663	SAB	96 tests	EUR 663.6
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Insulin-like peptide INSL5,Insulin-like peptide 5 in samples from serum, plasma, tissue homogenates and other biological fluids.

Insulin Receptor (INSR) Blocking Peptide
20-abx161901	Abbexa	EUR 326.40 EUR 493.20	1 mg 5 mg

Insulin Receptor (INSR) Blocking Peptide
20-abx062798	Abbexa	EUR 326.40 EUR 493.20	1 mg 5 mg

Insulin Receptor (INSR) Amide Peptide
20-abx266403	Abbexa	EUR 627.60 EUR 1045.20 EUR 460.80	10 mg 25 mg 5 mg

Insulin Receptor beta Blocking Peptide
DF6088-BP	Affbiotech	1mg	EUR 234

Mouse Insulin-like peptide INSL5 (INSL5) ELISA Kit
abx574867-96tests	Abbexa	96 tests	EUR 801.6

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit
CSB-EL011749MO-24T	Cusabio	1 plate of 24 wells	EUR 198
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit
1-CSB-EL011749MO	Cusabio	EUR 964.80 EUR 6118.80 EUR 3244.80	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Insulin- like peptide INSL5, Insl5 ELISA KIT
ELI-43454m	Lifescience Market	96 Tests	EUR 1038

Mouse Insulin- like peptide INSL6, Insl6 ELISA KIT
ELI-13429m	Lifescience Market	96 Tests	EUR 1038

Control/Blocking peptide for Mouse TATA box-binding protein
TATAB11-C	Alpha Diagnostics	100 ug	EUR 196.8

Monoclonal Anti-Human Insulin C-peptide IgG, aff pure
INSC23-M	Alpha Diagnostics	100 ul	EUR 578.4

Recombinant Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control
IGFBP33-C	Alpha Diagnostics	100 ul	EUR 343.2

Control/Blocking peptide for Mouse Neuronal migration protein doublecortin (DCX)
DCX11-C	Alpha Diagnostics	100 ug	EUR 196.8

Control/Blocking peptide for Mouse Neurogenic differentation factor 1 (NeuroD1)
NEUD1-C	Alpha Diagnostics	100 ug	EUR 196.8

Control/Blocking peptide CD40
CD4011-C	Alpha Diagnostics	100 ug	EUR 196.8

Control/Blocking peptide EOMES
EMS11-C	Alpha Diagnostics	100 ug	EUR 196.8

Mouse C-Peptide(C-Peptide) ELISA Kit
EM0947	FN Test	96T	EUR 571.5
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 0.094 ng/ml

Mouse C-Peptide/ C-Peptide ELISA Kit
E0316Mo	Sunlong	1 Kit	EUR 685.2

Insulin Receptor (1142-1153) (Biotin) Peptide
20-abx266416	Abbexa	EUR 627.60 EUR 1045.20 EUR 460.80	10 mg 25 mg 5 mg

Phospho-Insulin Receptor (Tyr1355) Blocking Peptide
AF4392-BP	Affbiotech	1mg	EUR 234

Canine Insulin (INS) ELISA Kit
DLR-INS-c-48T	DL Develop	48T	EUR 748.8
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine Insulin (INS) ELISA Kit
DLR-INS-c-96T	DL Develop	96T	EUR 985.2
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine Insulin (INS) ELISA Kit
RDR-INS-c-48Tests	Reddot Biotech	48 Tests	EUR 806.4

Canine Insulin (INS) ELISA Kit
RDR-INS-c-96Tests	Reddot Biotech	96 Tests	EUR 1125.6

Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB
IGFBP13-C	Alpha Diagnostics	100 ul	EUR 343.2

Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB
IGFBP23-C	Alpha Diagnostics	100 ul	EUR 343.2

Recombinant (NSO) purified Mouse/Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB
IGFBP63-C	Alpha Diagnostics	100 ul	EUR 343.2

Recombinant (Sf21) purified Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB
IGFBP73-C	Alpha Diagnostics	100 ul	EUR 343.2

Control/Blocking peptide Human BCL-2
BCL11-C	Alpha Diagnostics	100 ug	EUR 196.8

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide
20-abx068858	Abbexa	EUR 844.80 EUR 343.20 EUR 2614.80 EUR 1011.60 EUR 610.80	100 ug 10 ug 1 mg 200 ug 50 ug

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide
20-abx068859	Abbexa	EUR 878.40 EUR 343.20 EUR 2766.00 EUR 1062.00 EUR 627.60	100 ug 10 ug 1 mg 200 ug 50 ug

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E03R0119-192T	BlueGene	192 tests	EUR 1524
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E03R0119-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E03R0119-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

RXFP1 ELISA Kit| Mouse Relaxin/Insulin Like Family Peptide Recep
EF012910	Lifescience Market	96 Tests	EUR 826.8

Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]
INSB25-P	Alpha Diagnostics	500 ug	EUR 416.4

Insulin Receptor (INSR) (Phospho-Y1355) Blocking Peptide
20-abx161651	Abbexa	EUR 376.80 EUR 610.80	1 mg 5 mg

Insulin Receptor (INSR) (Phospho-Y1361) Blocking Peptide
20-abx161652	Abbexa	EUR 376.80 EUR 610.80	1 mg 5 mg

Kinase Domain of Insulin Receptor (1) Peptide
20-abx266352	Abbexa	EUR 610.80 EUR 1028.40 EUR 444.00	10 mg 25 mg 5 mg

Insulin Like Growth Factor 1 (IGF1) Peptide
20-abx266444	Abbexa	EUR 661.20 EUR 1111.20 EUR 477.60	10 mg 25 mg 5 mg

Kinase Domain of Insulin Receptor (2) Peptide
20-abx266448	Abbexa	EUR 661.20 EUR 1111.20 EUR 477.60	10 mg 25 mg 5 mg

Insulin Receptor (1142-1153), amide (Biotin) Peptide
20-abx266464	Abbexa	EUR 661.20 EUR 1111.20 EUR 477.60	10 mg 25 mg 5 mg

IGF-I Receptor/Insulin Receptor Blocking Peptide
AF4697-BP	Affbiotech	1mg	EUR 234

Mouse Connecting Peptide (C-Peptide) ELISA Kit
20-abx156702	Abbexa	EUR 7970.40 EUR 4250.40 EUR 990.00	10 × 96 tests 5 × 96 tests 96 tests

Mouse Connecting Peptide (C-Peptide) ELISA Kit
abx051521-96tests	Abbexa	96 tests	EUR 904.8

Mouse C-Type Natriuretic Peptide (NPPC) Peptide
20-abx066174	Abbexa	EUR 811.20 EUR 343.20 EUR 2498.40 EUR 961.20 EUR 577.20	100 ug 10 ug 1 mg 200 ug 50 ug

Mouse C-Type Natriuretic Peptide (NPPC) Peptide
20-abx066178	Abbexa	EUR 811.20 EUR 343.20 EUR 2498.40 EUR 961.20 EUR 577.20	100 ug 10 ug 1 mg 200 ug 50 ug

Mouse Connecting Peptide (C-Peptide) ELISA Kit
abx255287-96tests	Abbexa	96 tests	EUR 801.6

Mouse Connecting Peptide (C-Peptide) ELISA Kit
abx576327-96tests	Abbexa	96 tests	EUR 801.6

Mouse C- Peptide, connecting peptide ELISA Kit
CELI-66099m	Lifescience Market	96 Tests	EUR 1038

Insulin C-terminal Antibody
abx021216-1mg	Abbexa	1 mg	EUR 944.4

C-Peptide ELISA Kit| Mouse C-Peptide ELISA Kit
EF013534	Lifescience Market	96 Tests	EUR 826.8

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
C988-10ug	Novoprotein	10ug	EUR 242.4
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
C988-1mg	Novoprotein	1mg	EUR 2739.6
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
C988-500ug	Novoprotein	500ug	EUR 1935.6
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
C988-50ug	Novoprotein	50ug	EUR 595.2
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Beta catenin 1 (CTNNB1) Control/Blocking Peptide
BCTN11-C	Alpha Diagnostics	100 ug	EUR 196.8

Rabbit anti-Lamin B1 Control/Blocking Peptide
BL11-C	Alpha Diagnostics	100 ug	EUR 196.8

Control/Blocking peptide for Ephrin-B2 antibody
NIVE2B-C	Alpha Diagnostics	100 ug	EUR 196.8

Control/Blocking peptide for Mouse Microtubule-associated proteins 1A/1B light chain 3B (anti-Map1lc3b)
MAP13B-C	Alpha Diagnostics	100 ug	EUR 196.8

Custom Peptide Synthesis (crude and desalted; mg-kg size, price based upon peptide size: 2-100 aa)
PEP-C	Alpha Diagnostics	1	Ask for price

Recombinant Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control
IGFBP31-C	Alpha Diagnostics	100 ul	EUR 343.2

Control/Blocking peptide Glutamate receptor ionotropic (NMDA/GRN1)
NMDA11-C	Alpha Diagnostics	100 ug	EUR 196.8

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit
abx254542-96tests	Abbexa	96 tests	EUR 848.4

Mouse Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) ELISA Kit
abx390435-96tests	Abbexa	96 tests	EUR 1093.2

Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit
EM0166	FN Test	96T	EUR 628.92
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 9.375pg/ml

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate)
RA0164-C.1	ScyTek Laboratories	0.1 ml	EUR 150

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate)
RA0164-C.5	ScyTek Laboratories	0.5 ml	EUR 360

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate)
RA0165-C.1	ScyTek Laboratories	0.1 ml	EUR 150

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate)
RA0165-C.5	ScyTek Laboratories	0.5 ml	EUR 360

Purified human recomb insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control
IGFBP51-C	Alpha Diagnostics	100 ul	EUR 343.2

Mouse C-Peptide ELISA Kit
CSB-E05068m-24T	Cusabio	1 plate of 24 wells	EUR 198
Description: Quantitativesandwich ELISA kit for measuring Mouse C-Peptide in samples from serum, plasma. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse C-Peptide ELISA Kit
1-CSB-E05068m	Cusabio	EUR 964.80 EUR 6118.80 EUR 3244.80	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse C-Peptide in samples from serum, plasma. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse C-Peptide ELISA Kit
CN-02863M1	ChemNorm	96T	EUR 549.6

Mouse C-Peptide ELISA Kit
CN-02863M2	ChemNorm	48T	EUR 368.4

Mouse C-Peptide ELISA Kit
EMC0815	Abclonal	96Tests	EUR 625.2

Mouse C peptide ELISA kit
E03C0042-192T	BlueGene	192 tests	EUR 1524
Description: A competitive ELISA for quantitative measurement of Mouse C peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse C peptide ELISA kit
E03C0042-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A competitive ELISA for quantitative measurement of Mouse C peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse C peptide ELISA kit
E03C0042-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A competitive ELISA for quantitative measurement of Mouse C peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse C-Peptide ELISA Kit
GA-E0019MS-48T	GenAsia Biotech	48T	EUR 403.2

Mouse C-Peptide ELISA Kit
GA-E0019MS-96T	GenAsia Biotech	96T	EUR 640.8

Mouse C- Peptide ELISA Kit
ELA-E0447m	Lifescience Market	96 Tests	EUR 1038

Mouse C-Peptide ELISA Kit
QY-E20396	Qayee Biotechnology	96T	EUR 433.2

C-Peptide II (Mouse) antibody
Y223	Sceti	50 ul	EUR 512.4
Description: The C-Peptide II (Mouse) antibody is available in Europe and for worldwide shipping via Gentaur.

Mouse C-Peptide ELISA Kit
YLA0348MO-48T	Shanghai YL Biotech	48T	EUR 465

Mouse C-Peptide ELISA Kit
YLA0348MO-96T	Shanghai YL Biotech	96T	EUR 600

Mouse C-Type Natriuretic Peptide (NPPC) Peptide (OVA)
20-abx651254	Abbexa	EUR 410.40 EUR 260.40 EUR 1128.00 EUR 510.00 EUR 343.20	100 ug 10 ug 1 mg 200 ug 50 ug

Insulin Like Growth Factor 1 (IGF1) Blocking Peptide
20-abx161136	Abbexa	EUR 326.40 EUR 493.20	1 mg 5 mg

Insulin Like Growth Factor 1 (IGF1) Analog Peptide
20-abx266295	Abbexa	EUR 594.00 EUR 978.00 EUR 427.20	10 mg 25 mg 5 mg

Kinase Domain of Insulin Receptor (2) (Biotin) Peptide
20-abx266404	Abbexa	EUR 627.60 EUR 1045.20 EUR 460.80	10 mg 25 mg 5 mg

Mouse Insulin C- peptide