Mouse Insulin C- peptide

Mouse Insulin C- peptide

Contact us: [email protected]

Mouse Insulin- like peptide INSL6, Insl6 ELISA KIT

ELI-13429m 96 Tests
EUR 1038

Human Insulin B Peptide

abx670051-5mg 5 mg
EUR 427.2

Mouse Insulin-like peptide INSL5 (INSL5) ELISA Kit

abx574867-96tests 96 tests
EUR 801.6

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

CSB-EL011749MO-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

1-CSB-EL011749MO
  • EUR 964.80
  • EUR 6118.80
  • EUR 3244.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Insulin-like peptide INSL5 (INSL5) ELISA Kit

RK13149 96T
EUR 280

Mouse Insulin-like peptide INSL5(INSL5) Elisa kit

EK731135 96 Wells
EUR 0.75

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

EKC37110-48T 48T
EUR 535.99

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

EKC37110-5x96T 5x96T
EUR 3637.08

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

EKC37110-96T 96T
EUR 765.7

Mouse Insulin Like peptide INSL5, INSL5 GENLISA ELISA

KLM2151 1 x 96 wells
EUR 341

Insulin Blocking Peptide

20-abx064168
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Blocking Peptide

20-abx064169
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Blocking Peptide

AF5109-BP 1mg
EUR 234

ELISA kit for Human Insulin-like peptide INSL5,Insulin-like peptide 5

EK2663 96 tests
EUR 663.6
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Insulin-like peptide INSL5,Insulin-like peptide 5 in samples from serum, plasma, tissue homogenates and other biological fluids.

Insulin-like peptide INSL6

AP84213 1mg
EUR 2640

Insulin-like peptide INSL5

AP84306 1mg
EUR 2640

Insulin-like peptide INSL5

AP84387 1mg
EUR 2640

Insulin-like peptide INSL6

AP84433 1mg
EUR 2640

Insulin-like peptide INSL6

AP79811 1mg
EUR 2640

Insulin Receptor (INSR) Peptide

20-abx266328
  • EUR 594.00
  • EUR 978.00
  • EUR 427.20
  • 10 mg
  • 25 mg
  • 5 mg

Insulin β Chain Peptide (15-23)

T40132-10mg 10mg Ask for price
Description: Insulin β Chain Peptide (15-23)

Insulin β Chain Peptide (15-23)

T40132-1g 1g Ask for price
Description: Insulin β Chain Peptide (15-23)

Insulin β Chain Peptide (15-23)

T40132-1mg 1mg Ask for price
Description: Insulin β Chain Peptide (15-23)

Insulin β Chain Peptide (15-23)

T40132-50mg 50mg Ask for price
Description: Insulin β Chain Peptide (15-23)

Insulin β Chain Peptide (15-23)

T40132-5mg 5mg Ask for price
Description: Insulin β Chain Peptide (15-23)

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA

E01A24957 96T
EUR 700
Description: ELISA

Insulin Receptor Blocking Peptide

AF4692-BP 1mg
EUR 234

Insulin Receptor (INSR) Amide Peptide

20-abx266403
  • EUR 627.60
  • EUR 1045.20
  • EUR 460.80
  • 10 mg
  • 25 mg
  • 5 mg

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

RXFP1 ELISA Kit| Mouse Relaxin/Insulin Like Family Peptide Recep

EF012910 96 Tests
EUR 826.8

Mouse Relaxin/Insulin Like Family Peptide Receptor 3 ELISA kit

E01A25163 96T
EUR 700
Description: ELISA

Mouse Relaxin/Insulin Like Family Peptide Receptor 2 ELISA kit

E01A25164 96T
EUR 700
Description: ELISA

Mouse Relaxin/Insulin Like Family Peptide Receptor 4 ELISA kit

E01A25165 96T
EUR 700
Description: ELISA

Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]

INSB25-P 500 ug
EUR 416.4

Insulin Receptor (INSR) Blocking Peptide

20-abx062798
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Receptor (INSR) Blocking Peptide

20-abx161901
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Early placenta insulin-like peptide

AP84750 1mg
EUR 2640

Goat Anti-Human/mouse/rat Insulin chain A peptide IgG, aff pure

INSA21-A 100 ul
EUR 578.4

Insulin Receptor beta Blocking Peptide

DF6088-BP 1mg
EUR 234

Insulin Receptor (1142-1153) (Biotin) Peptide

20-abx266416
  • EUR 627.60
  • EUR 1045.20
  • EUR 460.80
  • 10 mg
  • 25 mg
  • 5 mg

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit

abx254542-96tests 96 tests
EUR 848.4

Mouse Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) ELISA Kit

abx390435-96tests 96 tests
EUR 1093.2

Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit

EM0166 96T
EUR 628.92
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 9.375pg/ml

Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit

EKF59220-48T 48T
EUR 396.9

Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit

EKF59220-5x96T 5x96T
EUR 2693.25

Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit

EKF59220-96T 96T
EUR 567

Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit

RE2148M-48wells 48 wells
EUR 116.55

Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit

RE2148M-96wells 96 wells
EUR 161.55

Monoclonal Anti-Human/mouse/rat Insulin chain B peptide IgG, aff pure

INSB22-M 100 ul
EUR 578.4

Human Insulin Like Peptide 5 (INSL5) ELISA

KT-50582 96 tests
EUR 975

ELISA kit for Mouse RXFP1 (Relaxin/Insulin Like Family Peptide Receptor 1)

E-EL-M1010 1 plate of 96 wells
EUR 640.8
Description: A sandwich ELISA kit for quantitative measurement of Mouse RXFP1 (Relaxin/Insulin Like Family Peptide Receptor 1) in samples from Serum, Plasma, Cell supernatant

Insulin Like Growth Factor 1 (IGF1) Peptide

20-abx266444
  • EUR 661.20
  • EUR 1111.20
  • EUR 477.60
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Receptor (1142-1153), amide (Biotin) Peptide

20-abx266464
  • EUR 661.20
  • EUR 1111.20
  • EUR 477.60
  • 10 mg
  • 25 mg
  • 5 mg

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide

20-abx068858
  • EUR 844.80
  • EUR 343.20
  • EUR 2614.80
  • EUR 1011.60
  • EUR 610.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide

20-abx068859
  • EUR 878.40
  • EUR 343.20
  • EUR 2766.00
  • EUR 1062.00
  • EUR 627.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Kinase Domain of Insulin Receptor (1) Peptide

20-abx266352
  • EUR 610.80
  • EUR 1028.40
  • EUR 444.00
  • 10 mg
  • 25 mg
  • 5 mg

Kinase Domain of Insulin Receptor (2) Peptide

20-abx266448
  • EUR 661.20
  • EUR 1111.20
  • EUR 477.60
  • 10 mg
  • 25 mg
  • 5 mg

Human Insulin-Like Peptide INSL5 GENLISA ELISA

KBH4843 1 x 96 wells
EUR 286

Human Insulin- like peptide INSL6, INSL6 ELISA KIT

ELI-12379h 96 Tests
EUR 988.8

Human Insulin- like peptide INSL5, INSL5 ELISA KIT

ELI-20454h 96 Tests
EUR 988.8

Bovine Insulin- like peptide INSL6, INSL6 ELISA KIT

ELI-42113b 96 Tests
EUR 1113.6

Rxfp2 (untagged) - Mouse relaxin/insulin-like family peptide receptor 2 (Rxfp2), (10ug)

MC221250 10 µg Ask for price

Rxfp1 (untagged) - Mouse relaxin/insulin-like family peptide receptor 1 (Rxfp1), (10ug)

MC221411 10 µg Ask for price

Insulin Like Growth Factor 1 (IGF1) (30-41) Peptide

20-abx266288
  • EUR 594.00
  • EUR 978.00
  • EUR 427.20
  • 10 mg
  • 25 mg
  • 5 mg

Human Insulin-like peptide INSL5 (INSL5) ELISA Kit

abx570706-96tests 96 tests
EUR 801.6

Human Insulin-like peptide INSL5(INSL5) ELISA kit

CSB-EL011749HU-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Insulin-like peptide INSL5(INSL5) ELISA kit

1-CSB-EL011749HU
  • EUR 964.80
  • EUR 6118.80
  • EUR 3244.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human Insulin-like peptide INSL5 (INSL5) ELISA Kit

RK10978 96T
EUR 280

Human Insulin-like peptide INSL6 (INSL6) ELISA Kit

RK11214 96T
EUR 280

Human Insulin-like peptide INSL6 (INSL6) ELISA Kit

AE58491HU-48Tests 48 Tests
EUR 325
Description: Human (Homo sapiens)

Human Insulin-like peptide INSL6 (INSL6) ELISA Kit

AE58491HU-96Tests 96 Tests
EUR 610
Description: Human (Homo sapiens)

Human Insulin-like peptide INSL5(INSL5) ELISA kit

EKC42536-48T 48T
EUR 542.78

Human Insulin-like peptide INSL5(INSL5) ELISA kit

EKC42536-5x96T 5x96T
EUR 3683.15

Human Insulin-like peptide INSL5(INSL5) ELISA kit

EKC42536-96T 96T
EUR 775.4

Human Insulin-like peptide INSL6 (INSL6) ELISA Kit

EK11234 96Т
EUR 799

IGF-I Receptor/Insulin Receptor Blocking Peptide

AF4697-BP 1mg
EUR 234

Bovine Insulin-like peptide INSL6 (INSL6) ELISA Kit

AE60752BO-48Tests 48 Tests
EUR 360
Description: Bovine (Bos taurus; Cattle)

Bovine Insulin-like peptide INSL6 (INSL6) ELISA Kit

AE60752BO-96Tests 96 Tests
EUR 680
Description: Bovine (Bos taurus; Cattle)

Bovine Insulin-like peptide INSL6 (INSL6) ELISA Kit

EK11546 96Т
EUR 799

Insulin Like Growth Factor 1 (IGF1) Analog Peptide

20-abx266295
  • EUR 594.00
  • EUR 978.00
  • EUR 427.20
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Like Growth Factor 1 (IGF1) (1-3) Peptide

20-abx265710
  • EUR 393.60
  • EUR 594.00
  • EUR 326.40
  • 10 mg
  • 25 mg
  • 5 mg

Mouse/rat/hamster/Insulin A chain peptide (90-110 aa; Cys-95-Cys100) [GIVDQCCTSICSLYQLENYCN]

INSA15-P 500 ug
EUR 343.2

Human Insulin-like peptide 5, ILP-5 ELISA Kit

SL3753Hu 96 Tests
EUR 468

Rxfp2 (GFP-tagged) - Mouse relaxin/insulin-like family peptide receptor 2 (Rxfp2), (10ug)

MG222701 10 µg Ask for price

Rxfp1 (GFP-tagged) - Mouse relaxin/insulin-like family peptide receptor 1 (Rxfp1), (10ug)

MG223089 10 µg Ask for price

Insulin Receptor (INSR) (Phospho-Y1355) Blocking Peptide

20-abx161651
  • EUR 376.80
  • EUR 610.80
  • 1 mg
  • 5 mg

Insulin Receptor (INSR) (Phospho-Y1361) Blocking Peptide

20-abx161652
  • EUR 376.80
  • EUR 610.80
  • 1 mg
  • 5 mg

Kinase Domain of Insulin Receptor (2) (Biotin) Peptide

20-abx266404
  • EUR 627.60
  • EUR 1045.20
  • EUR 460.80
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Like Growth Factor 1 (IGF1) Blocking Peptide

20-abx161136
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Rxfp1 (Myc-DDK-tagged) - Mouse relaxin/insulin-like family peptide receptor 1 (Rxfp1)

MR223089 10 µg Ask for price

Rxfp2 (Myc-DDK-tagged) - Mouse relaxin/insulin-like family peptide receptor 2 (Rxfp2)

MR222701 10 µg Ask for price

ELISA kit for Human Insulin-like peptide INSL6 (INSL6)

KTE62243-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Insulin-like peptide INSL6 (INSL6)

KTE62243-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Insulin-like peptide INSL6 (INSL6)

KTE62243-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)

KTE10416-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)

KTE10416-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)

KTE10416-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Human Early placenta insulin- like peptide, INSL4 ELISA KIT

ELI-03359h 96 Tests
EUR 988.8

Rat Relaxin/Insulin Like Family Peptide Receptor 1 ELISA

E01A16210 96T
EUR 700
Description: ELISA

Human Early placenta insulin-like peptide(INSL4) ELISA kit

CSB-EL011748HU-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Human Early placenta insulin-like peptide (INSL4) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Early placenta insulin-like peptide(INSL4) ELISA kit

1-CSB-EL011748HU
  • EUR 964.80
  • EUR 6118.80
  • EUR 3244.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human Early placenta insulin-like peptide(INSL4) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human INSL4/ Early placenta insulin-like peptide ELISA Kit

E1323Hu 1 Kit
EUR 685.2

Human INSL4(Early placenta insulin-like peptide) ELISA Kit

EH1173 96T
EUR 681.12
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

Human Early placenta insulin-like peptide (INSL4) ELISA Kit

RK07548 96T
EUR 280

Human Early placenta insulin-like peptide(INSL4) Elisa Kit

EK712762 96 Wells
EUR 0.29

Goat Relaxin/Insulin Like Family Peptide Receptor 1 ELISA

E01A51113 96T
EUR 700
Description: ELISA

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-10ug 10ug
EUR 242.4
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-1mg 1mg
EUR 2739.6
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-500ug 500ug
EUR 1935.6
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-50ug 50ug
EUR 595.2
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

AP75432 1mg
EUR 3209

Human Relaxin/Insulin Like Family Peptide Receptor 1 ELISA

E01A7465 96T
EUR 700
Description: ELISA

Sheep Relaxin/Insulin Like Family Peptide Receptor 1 ELISA

E01A103407 96T
EUR 700
Description: ELISA

Bovine Relaxin/Insulin Like Family Peptide Receptor 1 ELISA

E01A85980 96T
EUR 700
Description: ELISA

Rabbit Relaxin/Insulin Like Family Peptide Receptor 1 ELISA

E01A33679 96T
EUR 700
Description: ELISA

Monkey Relaxin/Insulin Like Family Peptide Receptor 1 ELISA

E01A77260 96T
EUR 700
Description: ELISA

Canine Relaxin/Insulin Like Family Peptide Receptor 1 ELISA

E01A68541 96T
EUR 700
Description: ELISA

Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide

20-abx062773
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide

20-abx062774
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide

20-abx161890
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Chicken Relaxin/Insulin Like Family Peptide Receptor 1 ELISA

E01A94693 96T
EUR 700
Description: ELISA

Porcine Relaxin/Insulin Like Family Peptide Receptor 1 ELISA

E01A59831 96T
EUR 700
Description: ELISA

Rxfp2 (untagged) - Mouse relaxin/insulin-like family peptide receptor 2 (Rxfp2), transcript variant 2

MC228748 10 µg Ask for price

Rxfp2 (untagged) - Mouse relaxin/insulin-like family peptide receptor 2 (Rxfp2), transcript variant 3

MC228788 10 µg Ask for price

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody

20-abx218407
  • EUR 510.00
  • EUR 410.40
  • 100 ug
  • 50 ug

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody

20-abx104448
  • EUR 493.20
  • EUR 159.60
  • EUR 1378.80
  • EUR 678.00
  • EUR 376.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody

20-abx104449
  • EUR 493.20
  • EUR 159.60
  • EUR 1378.80
  • EUR 678.00
  • EUR 376.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx174369
  • EUR 1028.40
  • EUR 526.80
  • 1 mg
  • 200 ug

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx178245
  • EUR 1446.00
  • EUR 693.60
  • 1 mg
  • 200 ug

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx212781
  • EUR 493.20
  • EUR 360.00
  • 100 ul
  • 50 ul

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx211855
  • EUR 493.20
  • EUR 360.00
  • 100 ul
  • 50 ul

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx119157
  • EUR 376.80
  • EUR 117.60
  • EUR 477.60
  • EUR 594.00
  • 100 ug
  • 10 ug
  • 200 ug
  • 300 µg

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx321215
  • EUR 526.80
  • EUR 393.60
  • 100 ul
  • 50 ul

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx322026
  • EUR 526.80
  • EUR 393.60
  • 100 ul
  • 50 ul

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx327281
  • EUR 376.80
  • EUR 292.80
  • 100 ug
  • 50 ug

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody

abx030698-400ul 400 ul
EUR 627.6

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody

abx030698-80l 80 µl
EUR 343.2

Mouse Insulin C- peptide