Accugel 19:1 40%

Accugel 19:1 40%

Contact us: [email protected]

450ML AccuGel 19:1 (30%)
NAT1176	National Diagnostics	450ML	EUR 105

1L AccuGel 19:1 (30%)
NAT1178	National Diagnostics	1L	EUR 138

FUNNEL, 40 MM, PP
6120P-40	CORNING	24/pk	EUR 44
Description: Reusable Plastics; Reusable Funnels

Acrylamide : bis 40%, 19:1 Solution
A0420-050	GenDepot	495ml	EUR 151

450ML AccuGel 29:1 (30%)
NAT1184	National Diagnostics	450ML	EUR 105

1L AccuGel 29:1 (30%)
NAT1186	National Diagnostics	1L	EUR 138

Nogo-66 (1-40)
B5247-1	ApexBio	1 mg	EUR 609

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Hu-48T	DL Develop	48T	EUR 479
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Hu-96T	DL Develop	96T	EUR 621
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Mu-48T	DL Develop	48T	EUR 489
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Mu-96T	DL Develop	96T	EUR 635
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Ra-48T	DL Develop	48T	EUR 508
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Ra-96T	DL Develop	96T	EUR 661
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Hu-48Tests	Reddot Biotech	48 Tests	EUR 478

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Hu-96Tests	Reddot Biotech	96 Tests	EUR 662

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Mu-48Tests	Reddot Biotech	48 Tests	EUR 489

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Mu-96Tests	Reddot Biotech	96 Tests	EUR 677

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Ra-48Tests	Reddot Biotech	48 Tests	EUR 511

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Ra-96Tests	Reddot Biotech	96 Tests	EUR 709

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Hu-48Tests	Reddot Biotech	48 Tests	EUR 500

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Hu-96Tests	Reddot Biotech	96 Tests	EUR 692

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Mu-48Tests	Reddot Biotech	48 Tests	EUR 511

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Mu-96Tests	Reddot Biotech	96 Tests	EUR 709

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Ra-48Tests	Reddot Biotech	48 Tests	EUR 534

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Ra-96Tests	Reddot Biotech	96 Tests	EUR 742

DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm
GFL-40	Creative Diagnostics	1 mL	EUR 1053

DiagNano Gold Nanoparticle Passive Conjugation Kit, 40 nm
GPK-40	Creative Diagnostics	1 kit	EUR 715

Acryl/Bis solution (19: 1), 40% (w/v)
A0006	Bio Basic	500ml	EUR 77.84

Amyloid Beta-Peptide (1-40) (human)
A1124-1	ApexBio	1 mg	EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Cytokeratin 19 (40 kD); Clone BA 17
A00094	ScyTek Laboratories	6 ml	EUR 220

Cytokeratin 19 (40 kD); Clone BA 17
A00094.0025	ScyTek Laboratories	25 ml	EUR 514

Cytokeratin 19 (40 kD); Clone BA 17
A20094	ScyTek Laboratories	2 ml	EUR 136

ExoDNAPS? Circulating and Exosome-associated DNA Extraction Kit (Human Plasma/Serum, 40 reactions)
K1230-40	Biovision		EUR 1061

ExoDNAUC? Circulating and Exosome-associated DNA Extraction Kit (Urine/Cell Media, 40 reactions)
K1231-40	Biovision		EUR 1061

CORNING® REUSABLE PHENOLIC GPI 40-400 THREADED SCREW CAP WITH RUBBER LINER
9999-40	CORNING	72/pk	EUR 140
Description: General Apparatus; Stoppers

TESTO (Testosterone) ELISA test
19	Biobase	96T/Box	Ask for price
Description: ELISA based test for quantitative detection of O (osterone)

FGF-19 Fibroblast Growth Factor-19 Human Recombinant Protein
PROTO95750-1	BosterBio	Regular: 25ug	EUR 317
Description: FGF19 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 195 amino acids and having a molecular mass of 21.8 kDa.;The FGF-19 is purified by proprietary chromatographic techniques.

DiagNano Gold Nanoparticle Medium Covalent Conjugation Kit, 40 nm
GCK-M-40	Creative Diagnostics	1 kit	EUR 757

DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm, Cellular Uptake
GFL-40-CU	Creative Diagnostics	1mL	EUR 1365

40 bp random library with flanking sequence; DNA aptamer
DAL-N-40	Alpha Diagnostics	100 ug	EUR 408

Polyclonal KRT19 / CK19 / Cytokeratin 19 Antibody (aa21-40)
APR17075G	Leading Biology	0.05mg	EUR 484
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human KRT19 / CK19 / Cytokeratin 19 (aa21-40). This antibody is tested and proven to work in the following applications:

DiagNano Gold Nanorods, diameter 40 nm, absorption max 550 nm
BR-40-550	Creative Diagnostics	25 mL	EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 600 nm
BR-40-600	Creative Diagnostics	25 mL	EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 650 nm
BR-40-650	Creative Diagnostics	25 mL	EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 750 nm
BR-40-750	Creative Diagnostics	25 mL	EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 780 nm
BR-40-780	Creative Diagnostics	25 mL	EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 808 nm
BR-40-808	Creative Diagnostics	25 mL	EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 850 nm
BR-40-850	Creative Diagnostics	25 mL	EUR 720

Anti-TCF-19 Antibody
A10508-1	BosterBio	100ul	EUR 397
Description: Rabbit Polyclonal Antibody for TCF-19 Antibody (TCF19) detection. Tested with WB in Human, Mouse, Rat.

Anti-Claudin-19 Antibody
A08096-1	BosterBio	100ul	EUR 397
Description: Rabbit Polyclonal Antibody for Claudin-19 Antibody (CLDN19) detection. Tested with WB in Human, Rat.

Anti-MMP-19 Antibody
A05171-1	BosterBio	100ul	EUR 397
Description: Rabbit Polyclonal Antibody for MMP-19 Antibody (MMP19) detection.tested for WB in Human, Mouse.

Abeta 40 (beta amyloid 1-40)
RA25009	Neuromics	100 ul	EUR 383

Anti-Cytokeratin 19
DB-103-1	DB Biotech	1 ml	EUR 450
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 550 nm
OR-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 600 nm
OR-40-600	Creative Diagnostics	1 mL	EUR 1022

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 650 nm
OR-40-650	Creative Diagnostics	1 mL	EUR 1022

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 700 nm
OR-40-700	Creative Diagnostics	1 mL	EUR 1022

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 750 nm
OR-40-750	Creative Diagnostics	1 mL	EUR 1022

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFA-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFA-40-650	Creative Diagnostics	1 mL	EUR 1022

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFA-40-700	Creative Diagnostics	1 mL	EUR 1022

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFA-40-750	Creative Diagnostics	1 mL	EUR 1022

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFB-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFB-40-600	Creative Diagnostics	1 mL	EUR 1022

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFB-40-650	Creative Diagnostics	1 mL	EUR 1022

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFB-40-750	Creative Diagnostics	1 mL	EUR 1022

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFC-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFC-40-600	Creative Diagnostics	1 mL	EUR 1022

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFC-40-650	Creative Diagnostics	1 mL	EUR 1022

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFC-40-700	Creative Diagnostics	1 mL	EUR 1022

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFC-40-750	Creative Diagnostics	1 mL	EUR 1022

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFM-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFM-40-650	Creative Diagnostics	1 mL	EUR 1022

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFM-40-700	Creative Diagnostics	1 mL	EUR 1022

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFM-40-750	Creative Diagnostics	1 mL	EUR 1022

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFN-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFN-40-600	Creative Diagnostics	1 mL	EUR 1022

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFN-40-650	Creative Diagnostics	1 mL	EUR 1022

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFN-40-700	Creative Diagnostics	1 mL	EUR 1022

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFN-40-750	Creative Diagnostics	1 mL	EUR 1022

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RCG-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RCG-40-600	Creative Diagnostics	1 mL	EUR 1022

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RCG-40-650	Creative Diagnostics	1 mL	EUR 1022

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RCG-40-700	Creative Diagnostics	1 mL	EUR 1022

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RCG-40-750	Creative Diagnostics	1 mL	EUR 1022

DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RCN-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RCN-40-600	Creative Diagnostics	1 mL	EUR 1022

DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RCN-40-650	Creative Diagnostics	1 mL	EUR 1022

DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RCN-40-700	Creative Diagnostics	1 mL	EUR 1022

DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RCS-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RCS-40-600	Creative Diagnostics	1 mL	EUR 1022

DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RCS-40-700	Creative Diagnostics	1 mL	EUR 1022

DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RCS-40-750	Creative Diagnostics	1 mL	EUR 1022

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFL-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFL-40-600	Creative Diagnostics	1 mL	EUR 1022

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFL-40-650	Creative Diagnostics	1 mL	EUR 1022

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFL-40-700	Creative Diagnostics	1 mL	EUR 1022

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFL-40-750	Creative Diagnostics	1 mL	EUR 1022

DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RGS-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RGS-40-650	Creative Diagnostics	1 mL	EUR 1022

DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RGS-40-700	Creative Diagnostics	1 mL	EUR 1022

DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RGS-40-750	Creative Diagnostics	1 mL	EUR 1022

Recombinant Human IL-19 Protein
PROTQ9UHD0-1	BosterBio	10ug	EUR 317
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant human IL-19 is a 17.9 kDa protein containing 153 amino acid residues. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.

FGF-19, human recombinant protein
P1050-.1	ApexBio	100 µg	EUR 738
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis.

FGF-19, human recombinant protein
P1050-1	ApexBio	1 mg	EUR 4156
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis.

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RCA-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RCA-40-600	Creative Diagnostics	1 mL	EUR 1022

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RCA-40-650	Creative Diagnostics	1 mL	EUR 1022

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RCA-40-700	Creative Diagnostics	1 mL	EUR 1022

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RCA-40-750	Creative Diagnostics	1 mL	EUR 1022

DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 550 nm
RCK-40-550	Creative Diagnostics	1 kit	EUR 1043

DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 600 nm
RCK-40-600	Creative Diagnostics	1 kit	EUR 1043

DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 650 nm
RCK-40-650	Creative Diagnostics	1 kit	EUR 1043

DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 700 nm
RCK-40-700	Creative Diagnostics	1 kit	EUR 1043

DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 750 nm
RCK-40-750	Creative Diagnostics	1 kit	EUR 1043

Human Cyclophilin-40 (PPID) AssayMax ELISA Kit
EC2050-1	AssayPro	96 Well Plate	EUR 417

DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RHA-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RHA-40-750	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RHG-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RHG-40-600	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RHG-40-650	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RHG-40-750	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RHM-40-650	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RHM-40-750	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RMG-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RMG-40-600	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RMG-40-650	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RMG-40-700	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RMG-40-750	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RRG-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RRG-40-600	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RRG-40-650	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RRG-40-700	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RRG-40-750	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RHA-40-600	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RHA-40-650	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RHG-40-700	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RHM-40-550	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RHM-40-600	Creative Diagnostics	1 mL	EUR 1022

DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RHM-40-700	Creative Diagnostics	1 mL	EUR 1022

Anti-Cytokeratin 19 Rabbit Monoclonal Antibody
M02101-1	BosterBio	100ug/vial	EUR 397
Description: Rabbit Monoclonal Cytokeratin 19 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse.

[Ser25] Protein Kinase C (19-31)
A1033-1	ApexBio	1 mg	EUR 102
Description: Protein Kinase C (19-31), (C67H118N26O17), a peptide with the sequence H-ARG-PHE-ALA-ARG-LYS-GLY-SER-LEU-ARG-GLN-LYS-ASN-VAL-OH, MW= 1559.82.

Synthetic Amyloid Beta Peptide 1-40 (Ab1-40)
4-SPA864Hu02	Cloud-Clone	EUR 350.88 EUR 197.00 EUR 1040.80 EUR 413.60 EUR 727.20 EUR 298.00 EUR 2452.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody
20-abx132222	Abbexa	EUR 425.00 EUR 133.00 EUR 1177.00 EUR 578.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody
20-abx175368	Abbexa	EUR 398.00 EUR 133.00 EUR 1094.00 EUR 537.00 EUR 314.00	100 ug 10 ug 1 mg 200 ug 50 ug

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody
20-abx175369	Abbexa	EUR 411.00 EUR 133.00 EUR 1135.00 EUR 551.00 EUR 314.00	100 ug 10 ug 1 mg 200 ug 50 ug

β-Amyloid (1-40)
HY-P0265	MedChemExpress	5mg	EUR 587

beta-Amyloid(40-1)
5-00456	CHI Scientific	4 x 1mg	Ask for price

egg white lysozyme (19-36) [Gallus gallus]
A1065-1	ApexBio	1 mg	EUR 108
Description: Sequence: H2N-KVFGRCELAAAMKRHGLD-OHFormula of Egg white lysozyme (19-36) [Gallus gallus]:C86H144N28O23S2Hen egg white lysozyme has a molecular weight of about 14,600 and each molecule comprises 129 amino acid residues1.

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Hu11	Cloud-Clone	EUR 221.86 EUR 162.00 EUR 556.96 EUR 252.32 EUR 404.64 EUR 211.00 EUR 1242.40	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Hu21	Cloud-Clone	EUR 431.52 EUR 218.00 EUR 1343.20 EUR 514.40 EUR 928.80 EUR 352.00 EUR 3208.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Hu23	Cloud-Clone	EUR 341.02 EUR 194.00 EUR 1003.84 EUR 401.28 EUR 702.56 EUR 291.00 EUR 2359.60	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Hu31	Cloud-Clone	EUR 246.05 EUR 169.00 EUR 647.68 EUR 282.56 EUR 465.12 EUR 227.00 EUR 1469.20	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Mu11	Cloud-Clone	EUR 221.86 EUR 162.00 EUR 556.96 EUR 252.32 EUR 404.64 EUR 211.00 EUR 1242.40	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Mu21	Cloud-Clone	EUR 221.86 EUR 162.00 EUR 556.96 EUR 252.32 EUR 404.64 EUR 211.00 EUR 1242.40	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Mu31	Cloud-Clone	EUR 246.05 EUR 169.00 EUR 647.68 EUR 282.56 EUR 465.12 EUR 227.00 EUR 1469.20	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Ra11	Cloud-Clone	EUR 221.86 EUR 162.00 EUR 556.96 EUR 252.32 EUR 404.64 EUR 211.00 EUR 1242.40	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Ra21	Cloud-Clone	EUR 221.86 EUR 162.00 EUR 556.96 EUR 252.32 EUR 404.64 EUR 211.00 EUR 1242.40	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Ra31	Cloud-Clone	EUR 246.05 EUR 169.00 EUR 647.68 EUR 282.56 EUR 465.12 EUR 227.00 EUR 1469.20	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

Rat beta-40(Amyloid Beta 1-40) ELISA Kit
STJ150091	St John's Laboratory	1 kit	EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Rat serum, plasma and other biological fluids

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide
20-abx652283	Abbexa	EUR 314.00 EUR 203.00 EUR 773.00 EUR 342.00 EUR 258.00	100 ug 10 ug 1 mg 200 ug 50 ug

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide
abx670346-1mg	Abbexa	1 mg	EUR 523

Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
CSB-E08299h-24T	Cusabio	1 plate of 24 wells	EUR 165
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid (CSF). A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
1-CSB-E08299h	Cusabio	EUR 900.00 EUR 5476.00 EUR 2900.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid(CSF). Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
CSB-E08300m-24T	Cusabio	1 plate of 24 wells	EUR 165
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
1-CSB-E08300m	Cusabio	EUR 946.00 EUR 5782.00 EUR 3060.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
CSB-E08302r-24T	Cusabio	1 plate of 24 wells	EUR 165
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
1-CSB-E08302r	Cusabio	EUR 967.00 EUR 5925.00 EUR 3134.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

ELISA kit for Monkey A?1-40 (Amyloid Beta 1-40)
E-EL-MK0477	Elabscience Biotech	1 plate of 96 wells	EUR 584
Description: A sandwich ELISA kit for quantitative measurement of Monkey A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Rat A?1-40 (Amyloid Beta 1-40)
E-EL-R1401	Elabscience Biotech	1 plate of 96 wells	EUR 377
Description: A sandwich ELISA kit for quantitative measurement of Rat A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human A?1-40 (Amyloid Beta 1-40)
E-EL-H0542	Elabscience Biotech	1 plate of 96 wells	EUR 377
Description: A sandwich ELISA kit for quantitative measurement of Human A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Mouse A?1-40 (Amyloid Beta 1-40)
E-EL-M0067	Elabscience Biotech	1 plate of 96 wells	EUR 377
Description: A sandwich ELISA kit for quantitative measurement of Mouse A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant

Human amyloid beta peptide 1-40,A?1-40 ELISA Kit
201-12-1231	SunredBio	96 tests	EUR 440
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human C-peptide ELISA Kit, 96 tests, Quantitative
40	Alpha Diagnostics	1 kit	EUR 590

Mouse Insulin ELISA Kit, High Sensitivity, Quantitative, 96 tests
0030-40-1	Alpha Diagnostics	1 kit	EUR 712

Galanin (1-19) (human)
H-5754.0500	Bachem	0.5mg	EUR 393
Description: Sum Formula: C89H130N26O25; CAS# [136005-51-1]

Galanin (1-19) (human)
H-5754.1000	Bachem	1.0mg	EUR 696
Description: Sum Formula: C89H130N26O25; CAS# [136005-51-1]

KRT19 Human, Cytokeratin 19 Human Recombinant Protein , His Tag
PROTP08727-1	BosterBio	Regular: 20ug	EUR 317
Description: KRT19 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 423 amino acids (1-400) and having a molecular mass of 46.5kDa.;KRT19 is fused to a 23 amino acid His-Tag at N-terminus and purified by proprietary chromatographic techniques.

Beta 2 Microglobulin (B2M) Partially Pure (40-90%)
B2M17-N-1	Alpha Diagnostics	1 mg	EUR 286

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
CN-00638R1	ChemNorm	96T	EUR 481

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
CN-00638R2	ChemNorm	48T	EUR 332

Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
CN-01866R1	ChemNorm	96T	EUR 494

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
CN-02744M1	ChemNorm	96T	EUR 461

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
CN-02744M2	ChemNorm	48T	EUR 310

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
CN-03356H1	ChemNorm	96T	EUR 454

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
CN-03356H2	ChemNorm	48T	EUR 303

Horse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
CN-05164H1	ChemNorm	96T	EUR 464

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat)
4-PAA864Ra08	Cloud-Clone	EUR 243.00 EUR 2457.00 EUR 613.00 EUR 305.00 EUR 212.00	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40)

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
CEA864Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4273.35
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
CEA864Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 439.57
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Accugel 19:1 40%