Accugel 19:1 40%
Contact us: [email protected]
Acrylamide : bis 40%, 19:1 Solution |
A0420-050 |
GenDepot |
495ml |
EUR 181.2 |
Nogo-66 (1-40) |
B5247-1 |
ApexBio |
1 mg |
EUR 730.8 |
FUNNEL, 40 MM, PP |
6120P-40 |
CORNING |
24/pk |
EUR 52.8 |
Description: Reusable Plastics; Reusable Funnels |
Amyloid Beta-Peptide (1-40) (human) |
A1124-1 |
ApexBio |
1 mg |
EUR 226.8 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Acryl/Bis solution (19: 1), 40% (w/v) |
A0006 |
Bio Basic |
500ml |
EUR 93.41 |
|
Anti-Dog CRP Antibody | GCRP-40 |
GCRP-40 |
Immunology Consultants Laboratory |
1.0 mL |
EUR 145 |
Description: Anti-Dog CRP Antibody | GCRP-40 | Immunology Consultants Laboratory Host: Goat Format: Whole Serum Product Type: Primary Antibody Antibody Clonality: Polyclonal |
Anti-Dog CRP Antibody | RCRP-40 |
RCRP-40 |
Immunology Consultants Laboratory |
1.0 mL |
EUR 153 |
Description: Anti-Dog CRP Antibody | RCRP-40 | Immunology Consultants Laboratory Host: Rabbit Format: Whole Serum Product Type: Primary Antibody Antibody Clonality: Polyclonal |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Hu-48T |
DL Develop |
48T |
EUR 574.8 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Hu-96T |
DL Develop |
96T |
EUR 745.2 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Mu-48T |
DL Develop |
48T |
EUR 586.8 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Mu-96T |
DL Develop |
96T |
EUR 762 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Ra-48T |
DL Develop |
48T |
EUR 609.6 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Ra-96T |
DL Develop |
96T |
EUR 793.2 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 573.6 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 794.4 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 586.8 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 812.4 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 613.2 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 850.8 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 600 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 830.4 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 613.2 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 850.8 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 640.8 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 890.4 |
FGF-19 Recombinant Protein (Animal Free) |
40-719 |
ProSci |
5 ug |
EUR 323.7 |
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high-affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during brain development and embryogenesis. Recombinant Human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues. |
FGF-19 Recombinant Protein |
40-178-0005mg |
ProSci |
0.005 mg |
EUR 311.1 |
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during the brain development and embryogenesis. Recombinant human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues. |
FGF-19 Recombinant Protein |
40-178-0025mg |
ProSci |
0.025 mg |
EUR 437.1 |
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during the brain development and embryogenesis. Recombinant human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues. |
IL-19 Recombinant Protein |
40-264-0002mg |
ProSci |
0.002 mg |
EUR 311.1 |
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant Human IL-19 is a 35.8 kDa homodimer of two 154 amino acid chains. In solution IL-19 exists predominantly as a non-disulfide-linked dimer. |
IL-19 Recombinant Protein |
40-264-001mg |
ProSci |
0.01 mg |
EUR 437.1 |
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant Human IL-19 is a 35.8 kDa homodimer of two 154 amino acid chains. In solution IL-19 exists predominantly as a non-disulfide-linked dimer. |
Normal Dog Serum | RS-40-100ML |
RS-40-100ML |
Immunology Consultants Laboratory |
100 mL |
EUR 667 |
Description: Normal Dog Serum | RS-40-100ML | Immunology Consultants Laboratory Species Reactivity: Dog Format: Serum Product Type: Isotype Control Antibody clonality: Polyclonal |
FGF-19 Fibroblast Growth Factor-19 Human Recombinant Protein |
PROTO95750-1 |
BosterBio |
Regular: 25ug |
EUR 380.4 |
Description: FGF19 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 195 amino acids and having a molecular mass of 21.8 kDa.;The FGF-19 is purified by proprietary chromatographic techniques. |
TESTO (Testosterone) ELISA test |
19 |
Biobase |
96T/Box |
Ask for price |
|
Description: ELISA based test for quantitative detection of O (osterone) |
Anti-MMP-19 Antibody |
A05171-1 |
BosterBio |
100ul |
EUR 476.4 |
Description: Rabbit Polyclonal Antibody for MMP-19 Antibody (MMP19) detection.tested for WB in Human, Mouse. |
Anti-Claudin-19 Antibody |
A08096-1 |
BosterBio |
100ul |
EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Claudin-19 Antibody (CLDN19) detection. Tested with WB in Human, Rat. |
Anti-TCF-19 Antibody |
A10508-1 |
BosterBio |
100ul |
EUR 476.4 |
Description: Rabbit Polyclonal Antibody for TCF-19 Antibody (TCF19) detection. Tested with WB in Human, Mouse, Rat. |
Polyclonal KRT19 / CK19 / Cytokeratin 19 Antibody (aa21-40) |
APR17075G |
Leading Biology |
0.05mg |
EUR 580.8 |
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human KRT19 / CK19 / Cytokeratin 19 (aa21-40). This antibody is tested and proven to work in the following applications: |
Methylamp Whole Cell Bisulfite Modification Kit |
P-1016 |
EpiGentek |
-
EUR 595.92
-
EUR 213.40
-
EUR 380.60
|
- 80 Samples
- 40 Samples
- 80 Samples
|
Anti-Cytokeratin 19 |
DB-103-1 |
DB Biotech |
1 ml |
EUR 540 |
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated |
Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
1-CSB-E08299h |
Cusabio |
-
EUR 1080.00
-
EUR 6571.20
-
EUR 3480.00
|
- 1 plate of 96 wells
- 10 plates of 96 wells each
- 5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid(CSF). Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
1-CSB-E08300m |
Cusabio |
-
EUR 1135.20
-
EUR 6938.40
-
EUR 3672.00
|
- 1 plate of 96 wells
- 10 plates of 96 wells each
- 5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
1-CSB-E08302r |
Cusabio |
-
EUR 1160.40
-
EUR 7110.00
-
EUR 3760.80
|
- 1 plate of 96 wells
- 10 plates of 96 wells each
- 5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Abeta 40 (beta amyloid 1-40) |
RA25009 |
Neuromics |
100 ul |
EUR 459.6 |
FGF-19, human recombinant protein |
P1050-.1 |
ApexBio |
100 µg |
EUR 885.6 |
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis. |
FGF-19, human recombinant protein |
P1050-1 |
ApexBio |
1 mg |
EUR 4987.2 |
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis. |
Recombinant Human IL-19 Protein |
PROTQ9UHD0-1 |
BosterBio |
10ug |
EUR 380.4 |
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant human IL-19 is a 17.9 kDa protein containing 153 amino acid residues. In solution IL-19 exists predominantly as a non-disulfide-linked dimer. |
CORNING® REUSABLE PHENOLIC GPI 40-400 THREADED SCREW CAP WITH RUBBER LINER |
9999-40 |
CORNING |
72/pk |
EUR 168 |
Description: General Apparatus; Stoppers |
ExoDNAPS? Circulating and Exosome-associated DNA Extraction Kit (Human Plasma/Serum, 40 reactions) |
K1230-40 |
Biovision |
|
EUR 1273.2 |
ExoDNAUC? Circulating and Exosome-associated DNA Extraction Kit (Urine/Cell Media, 40 reactions) |
K1231-40 |
Biovision |
|
EUR 1273.2 |
SureTemp ™ Dual Convection Incubator, 40 Liters with SureTemp Data Logging Software, 115V |
H2505-40 |
Benchmark Scientific |
1 each |
EUR 1941.9 |
Human Cyclophilin-40 (PPID) AssayMax ELISA Kit |
EC2050-1 |
AssayPro |
96 Well Plate |
EUR 500.4 |
40 bp random library with flanking sequence; DNA aptamer |
DAL-N-40 |
Alpha Diagnostics |
100 ug |
EUR 489.6 |
DiagNano Gold Nanoparticle Medium Covalent Conjugation Kit, 40 nm |
GCK-M-40 |
Creative Diagnostics |
1 kit |
EUR 908.4 |
DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm, Cellular Uptake |
GFL-40-CU |
Creative Diagnostics |
1mL |
EUR 1638 |
[Ser25] Protein Kinase C (19-31) |
A1033-1 |
ApexBio |
1 mg |
EUR 122.4 |
Description: Protein Kinase C (19-31), (C67H118N26O17), a peptide with the sequence H-ARG-PHE-ALA-ARG-LYS-GLY-SER-LEU-ARG-GLN-LYS-ASN-VAL-OH, MW= 1559.82. |
Anti-Cytokeratin 19 Rabbit Monoclonal Antibody |
M02101-1 |
BosterBio |
100ug/vial |
EUR 476.4 |
Description: Rabbit Monoclonal Cytokeratin 19 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse. |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 550 nm |
BR-40-550 |
Creative Diagnostics |
25 mL |
EUR 864 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 600 nm |
BR-40-600 |
Creative Diagnostics |
25 mL |
EUR 864 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 650 nm |
BR-40-650 |
Creative Diagnostics |
25 mL |
EUR 864 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 750 nm |
BR-40-750 |
Creative Diagnostics |
25 mL |
EUR 864 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 780 nm |
BR-40-780 |
Creative Diagnostics |
25 mL |
EUR 864 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 808 nm |
BR-40-808 |
Creative Diagnostics |
25 mL |
EUR 864 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 850 nm |
BR-40-850 |
Creative Diagnostics |
25 mL |
EUR 864 |
CrystalDirect Crystallization Plates; Pack of 40 |
M-XDIR-96-2-40 |
MiTeGen |
40 PLATES |
EUR 806 |
|
Description: CrystalDirect Crystallization Plates; Pack of 40 |
Histone H3 Methylation Antibody Panel Pack I – Active Genes |
C10000 |
EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack I – Repression Genes |
C10001 |
EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack II – Active Genes |
C10002 |
EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack II – Repression Genes |
C10003 |
EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack III – Active Genes |
C10004 |
EpiGentek |
|
|
Histone H3K4 Methylation Antibody Panel Pack |
C10005 |
EpiGentek |
|
|
Histone H3K9 Methylation Antibody Panel Pack |
C10006 |
EpiGentek |
|
|
Histone H3K27 Methylation Antibody Panel Pack |
C10007 |
EpiGentek |
|
|
Histone H3K36 Methylation Antibody Panel Pack |
C10008 |
EpiGentek |
|
|
Histone H3K79 Methylation Antibody Panel Pack |
C10009 |
EpiGentek |
|
|
Histone H3 Acetylation Antibody Panel Pack I |
C10010 |
EpiGentek |
|
|
Histone H3 Acetylation Antibody Panel Pack II |
C10011 |
EpiGentek |
|
|
Histone H4K20 Methylation Antibody Panel Pack |
C10012 |
EpiGentek |
|
|
Histone H4 Acetylation Antibody Panel Pack |
C10013 |
EpiGentek |
|
|
Histone H3 Phosphorylation Antibody Panel Pack |
C10014 |
EpiGentek |
|
|
Histone H3R2 Methylation Antibody Panel Pack |
C10015 |
EpiGentek |
|
|
Histone H3R8 Methylation Antibody Panel Pack |
C10016 |
EpiGentek |
|
|
Histone H3R17 Methylation Antibody Panel Pack |
C10017 |
EpiGentek |
|
|
Histone H3R26 Methylation Antibody Panel Pack |
C10018 |
EpiGentek |
|
|
Histone H4R3 Methylation Antibody Panel Pack |
C10019 |
EpiGentek |
|
|
DNA Methylation Antibody Panel Pack I |
C20000 |
EpiGentek |
|
|
Goat Anti-Rabbit Secondary Antibody, Biotin Conjugated |
A12001 |
EpiGentek |
|
|
Goat Anti-Rat Secondary Antibody, Biotin Conjugated |
A12002 |
EpiGentek |
|
|
HRP-Goat Anti-Mouse Secondary Antibody |
A12003 |
EpiGentek |
|
|
HRP-Goat Anti-Rabbit Secondary Antibody |
A12004 |
EpiGentek |
|
|
EpiMag HT (96-Well) Magnetic Separator |
Q10002 |
EpiGentek |
|
|
EpiMag 96-Well Microplate (5/pack) |
Q10003 |
EpiGentek |
|
|
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 550 nm |
OR-40-550 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 600 nm |
OR-40-600 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 650 nm |
OR-40-650 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 700 nm |
OR-40-700 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 750 nm |
OR-40-750 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFA-40-550 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFA-40-650 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RFA-40-700 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFA-40-750 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFB-40-550 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RFB-40-600 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFB-40-650 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFB-40-750 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFC-40-550 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RFC-40-600 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFC-40-650 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RFC-40-700 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFC-40-750 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFM-40-550 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFM-40-650 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RFM-40-700 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFM-40-750 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFN-40-550 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RFN-40-600 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFN-40-650 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RFN-40-700 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFN-40-750 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
egg white lysozyme (19-36) [Gallus gallus] |
A1065-1 |
ApexBio |
1 mg |
EUR 129.6 |
Description: Sequence: H2N-KVFGRCELAAAMKRHGLD-OHFormula of Egg white lysozyme (19-36) [Gallus gallus]:C86H144N28O23S2Hen egg white lysozyme has a molecular weight of about 14,600 and each molecule comprises 129 amino acid residues1. |
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
20-abx132222 |
Abbexa |
-
EUR 510.00
-
EUR 159.60
-
EUR 1412.40
-
EUR 693.60
-
EUR 393.60
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
20-abx175368 |
Abbexa |
-
EUR 477.60
-
EUR 159.60
-
EUR 1312.80
-
EUR 644.40
-
EUR 376.80
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
20-abx175369 |
Abbexa |
-
EUR 493.20
-
EUR 159.60
-
EUR 1362.00
-
EUR 661.20
-
EUR 376.80
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Synthetic Amyloid Beta Peptide 1-40 (Ab1-40) |
4-SPA864Hu02 |
Cloud-Clone |
-
EUR 421.06
-
EUR 236.40
-
EUR 1248.96
-
EUR 496.32
-
EUR 872.64
-
EUR 357.60
-
EUR 2942.40
|
- 100 ug
- 10ug
- 1 mg
- 200 ug
- 500 ug
- 50ug
- 5 mg
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli |
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RCG-40-550 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RCG-40-600 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RCG-40-650 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RCG-40-700 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RCG-40-750 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RCN-40-550 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RCN-40-600 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RCN-40-650 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RCN-40-700 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RCS-40-550 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RCS-40-600 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RCS-40-700 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RCS-40-750 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFL-40-550 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RFL-40-600 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFL-40-650 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RFL-40-700 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFL-40-750 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RGS-40-550 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RGS-40-650 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RGS-40-700 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RGS-40-750 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RCA-40-550 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RCA-40-600 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RCA-40-650 |
Creative Diagnostics |
1 mL |
EUR 1226.4 |
Accugel 19:1 40%