Accugel 19:1 40%

Accugel 19:1 40%

Contact us: [email protected]

450ML AccuGel 19:1 (30%)

NAT1176 450ML
EUR 75.24

1L AccuGel 19:1 (30%)

NAT1178 1L
EUR 119.7

Acrylamide : bis 40%, 19:1 Solution

A0420-050 495ml
EUR 181.2

Nogo-66 (1-40)

B5247-1 1 mg
EUR 730.8

450ML AccuGel 29:1 (30%)

NAT1184 450ML
EUR 71.82

1L AccuGel 29:1 (30%)

NAT1186 1L
EUR 119.7

FUNNEL, 40 MM, PP

6120P-40 24/pk
EUR 52.8
Description: Reusable Plastics; Reusable Funnels

40 x ELISA Wash Buffer

GR103014-40 1 L
EUR 238.8

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 226.8
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Anti-Dog CRP Antibody | GCRP-40

GCRP-40 1.0 mL
EUR 145
Description:

Anti-Dog CRP Antibody | GCRP-40 | Immunology Consultants Laboratory

Host: Goat

Format: Whole Serum

Product Type: Primary Antibody

Antibody Clonality: Polyclonal

Anti-Dog CRP Antibody | RCRP-40

RCRP-40 1.0 mL
EUR 153
Description:

Anti-Dog CRP Antibody | RCRP-40 | Immunology Consultants Laboratory

Host: Rabbit

Format: Whole Serum

Product Type: Primary Antibody

Antibody Clonality: Polyclonal

Acryl/Bis solution (19: 1), 40% (w/v)

A0006 500ml
EUR 93.41

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Hu-48T 48T
EUR 574.8
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Hu-96T 96T
EUR 745.2
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Mu-48T 48T
EUR 586.8
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Mu-96T 96T
EUR 762
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-48T 48T
EUR 609.6
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-96T 96T
EUR 793.2
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-48Tests 48 Tests
EUR 573.6

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-96Tests 96 Tests
EUR 794.4

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Mu-48Tests 48 Tests
EUR 586.8

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Mu-96Tests 96 Tests
EUR 812.4

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-48Tests 48 Tests
EUR 613.2

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-96Tests 96 Tests
EUR 850.8

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-48Tests 48 Tests
EUR 600

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-96Tests 96 Tests
EUR 830.4

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Mu-48Tests 48 Tests
EUR 613.2

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Mu-96Tests 96 Tests
EUR 850.8

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-48Tests 48 Tests
EUR 640.8

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-96Tests 96 Tests
EUR 890.4

DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm

GFL-40 1 mL
EUR 1263.6

FGF-19 Recombinant Protein (Animal Free)

40-719 5 ug
EUR 323.7
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high-affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during brain development and embryogenesis. Recombinant Human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues.

Turbidity Std Ratio 40 NTU

CRSR-40-100 100ML
EUR 125.4

Turbidity Std Ratio 40 NTU

CRSR-40-1000 1L
EUR 557.46

Turbidity Std Ratio 40 NTU

CRSR-40-500 500ML
EUR 248.52

DiagNano Gold Nanoparticle Passive Conjugation Kit, 40 nm

GPK-40 1 kit
EUR 858

FGF-19 Recombinant Protein

40-178-0005mg 0.005 mg
EUR 311.1
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during the brain development and embryogenesis. Recombinant human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues.

FGF-19 Recombinant Protein

40-178-0025mg 0.025 mg
EUR 437.1
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during the brain development and embryogenesis. Recombinant human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues.

IL-19 Recombinant Protein

40-264-0002mg 0.002 mg
EUR 311.1
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant Human IL-19 is a 35.8 kDa homodimer of two 154 amino acid chains. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.

IL-19 Recombinant Protein

40-264-001mg 0.01 mg
EUR 437.1
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant Human IL-19 is a 35.8 kDa homodimer of two 154 amino acid chains. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.

Cytokeratin 19 (40 kD); Clone BA 17

A20094 2 ml
EUR 163.2

Cytokeratin 19 (40 kD); Clone BA 17

A00094 6 ml
EUR 264

Cytokeratin 19 (40 kD); Clone BA 17

A00094.0025 25 ml
EUR 616.8

Turbidity Std Non Ratio 40 NTU

CRS-40-100 100ML
EUR 118.56

Turbidity Std Non Ratio 40 NTU

CRS-40-1000 1L
EUR 557.46

Turbidity Std Non Ratio 40 NTU

CRS-40-500 500ML
EUR 235.98

Normal Dog Serum | RS-40-100ML

RS-40-100ML 100 mL
EUR 667
Description:

Normal Dog Serum | RS-40-100ML | Immunology Consultants Laboratory

Species Reactivity: Dog

Format: Serum

Product Type: Isotype Control

Antibody clonality: Polyclonal

FGF-19 Fibroblast Growth Factor-19 Human Recombinant Protein

PROTO95750-1 Regular: 25ug
EUR 380.4
Description: FGF19 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 195 amino acids and having a molecular mass of 21.8 kDa.;The FGF-19 is purified by proprietary chromatographic techniques.

TESTO (Testosterone) ELISA test

19 96T/Box Ask for price
Description: ELISA based test for quantitative detection of O (osterone)

Anti-MMP-19 Antibody

A05171-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for MMP-19 Antibody (MMP19) detection.tested for WB in Human, Mouse.

Anti-Claudin-19 Antibody

A08096-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for Claudin-19 Antibody (CLDN19) detection. Tested with WB in Human, Rat.

Anti-TCF-19 Antibody

A10508-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for TCF-19 Antibody (TCF19) detection. Tested with WB in Human, Mouse, Rat.

Polyclonal KRT19 / CK19 / Cytokeratin 19 Antibody (aa21-40)

APR17075G 0.05mg
EUR 580.8
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human KRT19 / CK19 / Cytokeratin 19 (aa21-40). This antibody is tested and proven to work in the following applications:

Methylamp Whole Cell Bisulfite Modification Kit 

P-1016
  • EUR 595.92
  • EUR 213.40
  • EUR 380.60
  • 80 Samples
  • 40 Samples
  • 80 Samples

USP 232 Revision 40 Inhalation 2B Mix 1

USP-INHL2B-1 125ML
EUR 108.3

USP 232 Revision 40 Oral 2B Mix 1

USP-ORAL2B-1 125ML
EUR 119.7

USP 232 Revision 40 Oral 3 Mix 1

USP-ORAL3-1 125ML
EUR 174.42

USP 232 Revision 40 Parenteral 2B Mix 1

USP-PARENT2B-1 125ML
EUR 108.3

Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

1-CSB-E08299h
  • EUR 1080.00
  • EUR 6571.20
  • EUR 3480.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid(CSF). Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

1-CSB-E08300m
  • EUR 1135.20
  • EUR 6938.40
  • EUR 3672.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

1-CSB-E08302r
  • EUR 1160.40
  • EUR 7110.00
  • EUR 3760.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Anti-Cytokeratin 19

DB-103-1 1 ml
EUR 540
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Abeta 40 (beta amyloid 1-40)

RA25009 100 ul
EUR 459.6

Fc Receptor Blocker; 4X Concentrate, 40 ml Conce

NB309-4X-40 40 ml of 4X concentrate
EUR 1550
Description: Fc Receptor Blocker; 4X Concentrate, 40 ml Concentrate

CORNING® REUSABLE PHENOLIC GPI 40-400 THREADED SCREW CAP WITH RUBBER LINER

9999-40 72/pk
EUR 168
Description: General Apparatus; Stoppers

SureTemp ™ Dual Convection Incubator, 40 Liters with SureTemp Data Logging Software, 115V

H2505-40 1 each
EUR 1941.9

ExoDNAPS? Circulating and Exosome-associated DNA Extraction Kit (Human Plasma/Serum, 40 reactions)

K1230-40 each
EUR 1273.2

ExoDNAUC? Circulating and Exosome-associated DNA Extraction Kit (Urine/Cell Media, 40 reactions)

K1231-40 each
EUR 1273.2

FGF-19, human recombinant protein

P1050-.1 100 µg
EUR 885.6
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis.

FGF-19, human recombinant protein

P1050-1 1 mg
EUR 4987.2
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis.

Recombinant Human IL-19 Protein

PROTQ9UHD0-1 10ug
EUR 380.4
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant human IL-19 is a 17.9 kDa protein containing 153 amino acid residues. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.

Human Cyclophilin-40 (PPID) AssayMax ELISA Kit

EC2050-1 96 Well Plate
EUR 500.4

40 bp random library with flanking sequence; DNA aptamer

DAL-N-40 100 ug
EUR 489.6

DiagNano Gold Nanoparticle Medium Covalent Conjugation Kit, 40 nm

GCK-M-40 1 kit
EUR 908.4

DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm, Cellular Uptake

GFL-40-CU 1mL
EUR 1638

[Ser25] Protein Kinase C (19-31)

A1033-1 1 mg
EUR 122.4
Description: Protein Kinase C (19-31), (C67H118N26O17), a peptide with the sequence H-ARG-PHE-ALA-ARG-LYS-GLY-SER-LEU-ARG-GLN-LYS-ASN-VAL-OH, MW= 1559.82.

Anti-Cytokeratin 19 Rabbit Monoclonal Antibody

M02101-1 100ug/vial
EUR 476.4
Description: Rabbit Monoclonal Cytokeratin 19 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse.

DiagNano Gold Nanorods, diameter 40 nm, absorption max 550 nm

BR-40-550 25 mL
EUR 864

DiagNano Gold Nanorods, diameter 40 nm, absorption max 600 nm

BR-40-600 25 mL
EUR 864

DiagNano Gold Nanorods, diameter 40 nm, absorption max 650 nm

BR-40-650 25 mL
EUR 864

DiagNano Gold Nanorods, diameter 40 nm, absorption max 750 nm

BR-40-750 25 mL
EUR 864

DiagNano Gold Nanorods, diameter 40 nm, absorption max 780 nm

BR-40-780 25 mL
EUR 864

DiagNano Gold Nanorods, diameter 40 nm, absorption max 808 nm

BR-40-808 25 mL
EUR 864

DiagNano Gold Nanorods, diameter 40 nm, absorption max 850 nm

BR-40-850 25 mL
EUR 864

CrystalDirect Crystallization Plates; Pack of 40

M-XDIR-96-2-40 40 PLATES
EUR 806
Description: CrystalDirect Crystallization Plates; Pack of 40

Histone H3 Methylation Antibody Panel Pack I – Active Genes

C10000
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Methylation Antibody Panel Pack I – Repression Genes

C10001
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Methylation Antibody Panel Pack II – Active Genes

C10002
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3 Methylation Antibody Panel Pack II – Repression Genes

C10003
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Methylation Antibody Panel Pack III – Active Genes

C10004
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3K4 Methylation Antibody Panel Pack

C10005
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3K9 Methylation Antibody Panel Pack

C10006
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3K27 Methylation Antibody Panel Pack

C10007
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3K36 Methylation Antibody Panel Pack

C10008
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3K79 Methylation Antibody Panel Pack

C10009
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3 Acetylation Antibody Panel Pack I

C10010
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Acetylation Antibody Panel Pack II

C10011
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H4K20 Methylation Antibody Panel Pack

C10012
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H4 Acetylation Antibody Panel Pack

C10013
  • EUR 754.26
  • EUR 470.80
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Phosphorylation Antibody Panel Pack

C10014
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3R2 Methylation Antibody Panel Pack

C10015
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3R8 Methylation Antibody Panel Pack

C10016
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3R17 Methylation Antibody Panel Pack

C10017
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3R26 Methylation Antibody Panel Pack

C10018
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H4R3 Methylation Antibody Panel Pack

C10019
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

DNMT3A Protein

E11000
  • EUR 971.76
  • EUR 618.20
  • 10 µg
  • 10 ul

TET1 Protein (Active)

E12002
  • EUR 387.12
  • EUR 225.50
  • 10 µg
  • 10 ul

DNMT3B Protein 

E14000
  • EUR 971.76
  • EUR 618.20
  • 10 µg
  • 10 ul

DNMT1 Protein 

E15000
  • EUR 971.76
  • EUR 618.20
  • 10 µg
  • 10 ul

HDAC1 Protein 

E24002
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC10 Protein 

E24003
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC11 Protein 

E24004
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC2 Protein 

E24005
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC3 Protein 

E24006
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC4 Protein 

E24007
  • EUR 968.28
  • EUR 616.00
  • 10 µg
  • 10 ul

HDAC5 Protein 

E24008
  • EUR 968.28
  • EUR 616.00
  • 10 µg
  • 10 ul

HDAC6 Protein 

E24009
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC7 Protein 

E24010
  • EUR 968.28
  • EUR 616.00
  • 10 µg
  • 10 ul

HDAC8 Protein 

E24011
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC9 Protein 

E24012
  • EUR 968.28
  • EUR 616.00
  • 10 µg
  • 10 ul

H3F3A Protein 

E35003
  • EUR 174.84
  • EUR 78.10
  • 50 µg
  • 50 ul

H4 Protein 

E35005
  • EUR 174.84
  • EUR 78.10
  • 50 µg
  • 50 ul

SOD1 Protein 

E70000
  • EUR 599.40
  • EUR 365.20
  • 25 µg
  • 25 ul

Goat Anti-Rabbit Secondary Antibody, Biotin Conjugated

A12001
  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

Goat Anti-Rat Secondary Antibody, Biotin Conjugated

A12002
  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

HRP-Goat Anti-Mouse Secondary Antibody

A12003
  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

HRP-Goat Anti-Rabbit Secondary Antibody

A12004
  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

EpiMag HT (96-Well) Magnetic Separator

Q10002
  • EUR 416.70
  • EUR 258.50
  • 1/Pack
  • 1/Pack

EpiMag 96-Well Microplate (5/pack) 

Q10003
  • EUR 136.56
  • EUR 52.80
  • 5/pack
  • 5/pack

Human Genomic DNA 

X11000
  • Ask for price
  • EUR 235.40
  • 0.2 ml
  • 0.2 ml

Human Brain Genomic DNA  

X11001
  • Ask for price
  • EUR 77.00
  • 10 µg
  • 10 ul

DNA Methylation Antibody Panel Pack I

C20000
  • EUR 458.46
  • EUR 270.60
  • each
  • 2 x 25 ul

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 550 nm

OR-40-550 1 mL
EUR 1226.4

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 600 nm

OR-40-600 1 mL
EUR 1226.4

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 650 nm

OR-40-650 1 mL
EUR 1226.4

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 700 nm

OR-40-700 1 mL
EUR 1226.4

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 750 nm

OR-40-750 1 mL
EUR 1226.4

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 550 nm

RFA-40-550 1 mL
EUR 1226.4

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 650 nm

RFA-40-650 1 mL
EUR 1226.4

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 700 nm

RFA-40-700 1 mL
EUR 1226.4

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 750 nm

RFA-40-750 1 mL
EUR 1226.4

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 550 nm

RFB-40-550 1 mL
EUR 1226.4

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 600 nm

RFB-40-600 1 mL
EUR 1226.4

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 650 nm

RFB-40-650 1 mL
EUR 1226.4

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 750 nm

RFB-40-750 1 mL
EUR 1226.4

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 550 nm

RFC-40-550 1 mL
EUR 1226.4

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 600 nm

RFC-40-600 1 mL
EUR 1226.4

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 650 nm

RFC-40-650 1 mL
EUR 1226.4

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 700 nm

RFC-40-700 1 mL
EUR 1226.4

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 750 nm

RFC-40-750 1 mL
EUR 1226.4

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 550 nm

RFM-40-550 1 mL
EUR 1226.4

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 650 nm

RFM-40-650 1 mL
EUR 1226.4

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 700 nm

RFM-40-700 1 mL
EUR 1226.4

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 750 nm

RFM-40-750 1 mL
EUR 1226.4

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 550 nm

RFN-40-550 1 mL
EUR 1226.4

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 600 nm

RFN-40-600 1 mL
EUR 1226.4

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 650 nm

RFN-40-650 1 mL
EUR 1226.4

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 700 nm

RFN-40-700 1 mL
EUR 1226.4

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 750 nm

RFN-40-750 1 mL
EUR 1226.4

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

20-abx132222
  • EUR 510.00
  • EUR 159.60
  • EUR 1412.40
  • EUR 693.60
  • EUR 393.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

20-abx175368
  • EUR 477.60
  • EUR 159.60
  • EUR 1312.80
  • EUR 644.40
  • EUR 376.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

20-abx175369
  • EUR 493.20
  • EUR 159.60
  • EUR 1362.00
  • EUR 661.20
  • EUR 376.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Synthetic Amyloid Beta Peptide 1-40 (Ab1-40)

4-SPA864Hu02
  • EUR 421.06
  • EUR 236.40
  • EUR 1248.96
  • EUR 496.32
  • EUR 872.64
  • EUR 357.60
  • EUR 2942.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli

egg white lysozyme (19-36) [Gallus gallus]

A1065-1 1 mg
EUR 129.6
Description: Sequence: H2N-KVFGRCELAAAMKRHGLD-OHFormula of Egg white lysozyme (19-36) [Gallus gallus]:C86H144N28O23S2Hen egg white lysozyme has a molecular weight of about 14,600 and each molecule comprises 129 amino acid residues1.

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm

RCG-40-550 1 mL
EUR 1226.4

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm

RCG-40-600 1 mL
EUR 1226.4

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm

RCG-40-650 1 mL
EUR 1226.4

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm

RCG-40-700 1 mL
EUR 1226.4

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm

RCG-40-750 1 mL
EUR 1226.4

DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm

RCN-40-550 1 mL
EUR 1226.4

DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm

RCN-40-600 1 mL
EUR 1226.4

DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm

RCN-40-650 1 mL
EUR 1226.4

DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm

RCN-40-700 1 mL
EUR 1226.4

DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm

RCS-40-550 1 mL
EUR 1226.4

DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm

RCS-40-600 1 mL
EUR 1226.4

DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm

RCS-40-700 1 mL
EUR 1226.4

DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm

RCS-40-750 1 mL
EUR 1226.4

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 550 nm

RFL-40-550 1 mL
EUR 1226.4

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 600 nm

RFL-40-600 1 mL
EUR 1226.4

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 650 nm

RFL-40-650 1 mL
EUR 1226.4

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 700 nm

RFL-40-700 1 mL
EUR 1226.4

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 750 nm

RFL-40-750 1 mL
EUR 1226.4

DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm

RGS-40-550 1 mL
EUR 1226.4

DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm

RGS-40-650 1 mL
EUR 1226.4

DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm

RGS-40-700 1 mL
EUR 1226.4

DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm

RGS-40-750 1 mL
EUR 1226.4

beta-Amyloid(40-1)

5-00456 4 x 1mg Ask for price

β-Amyloid (1-40)

HY-P0265 5mg
EUR 704.4

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm

RCA-40-550 1 mL
EUR 1226.4

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm

RCA-40-600 1 mL
EUR 1226.4

Accugel 19:1 40%