Accugel 19:1 40%

Accugel 19:1 40%

Contact us: [email protected]

450ML AccuGel 19:1 (30%)
NAT1176	National Diagnostics	450ML	EUR 126

1L AccuGel 19:1 (30%)
NAT1178	National Diagnostics	1L	EUR 165.6

450ML AccuGel 29:1 (30%)
NAT1184	National Diagnostics	450ML	EUR 126

1L AccuGel 29:1 (30%)
NAT1186	National Diagnostics	1L	EUR 165.6

Acrylamide : bis 40%, 19:1 Solution
A0420-050	GenDepot	495ml	EUR 181.2

Nogo-66 (1-40)
B5247-1	ApexBio	1 mg	EUR 730.8

FUNNEL, 40 MM, PP
6120P-40	CORNING	24/pk	EUR 52.8
Description: Reusable Plastics; Reusable Funnels

40 x ELISA Wash Buffer
GR103014-40	Genorise Scientific	1 L	EUR 238.8

Amyloid Beta-Peptide (1-40) (human)
A1124-1	ApexBio	1 mg	EUR 226.8
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Acryl/Bis solution (19: 1), 40% (w/v)
A0006	Bio Basic	500ml	EUR 93.41

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Hu-48T	DL Develop	48T	EUR 574.8
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Hu-96T	DL Develop	96T	EUR 745.2
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Mu-48T	DL Develop	48T	EUR 586.8
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Mu-96T	DL Develop	96T	EUR 762
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Ra-48T	DL Develop	48T	EUR 609.6
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Ra-96T	DL Develop	96T	EUR 793.2
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Hu-48Tests	Reddot Biotech	48 Tests	EUR 573.6

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Hu-96Tests	Reddot Biotech	96 Tests	EUR 794.4

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Mu-48Tests	Reddot Biotech	48 Tests	EUR 586.8

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Mu-96Tests	Reddot Biotech	96 Tests	EUR 812.4

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Ra-48Tests	Reddot Biotech	48 Tests	EUR 613.2

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Ra-96Tests	Reddot Biotech	96 Tests	EUR 850.8

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Hu-48Tests	Reddot Biotech	48 Tests	EUR 600

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Hu-96Tests	Reddot Biotech	96 Tests	EUR 830.4

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Mu-48Tests	Reddot Biotech	48 Tests	EUR 613.2

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Mu-96Tests	Reddot Biotech	96 Tests	EUR 850.8

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Ra-48Tests	Reddot Biotech	48 Tests	EUR 640.8

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Ra-96Tests	Reddot Biotech	96 Tests	EUR 890.4

DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm
GFL-40	Creative Diagnostics	1 mL	EUR 1263.6

FGF-19 Recombinant Protein (Animal Free)
40-719	ProSci	5 ug	EUR 323.7
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high-affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during brain development and embryogenesis. Recombinant Human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues.

DiagNano Gold Nanoparticle Passive Conjugation Kit, 40 nm
GPK-40	Creative Diagnostics	1 kit	EUR 858

Cytokeratin 19 (40 kD); Clone BA 17
A20094	ScyTek Laboratories	2 ml	EUR 163.2

Cytokeratin 19 (40 kD); Clone BA 17
A00094	ScyTek Laboratories	6 ml	EUR 264

Cytokeratin 19 (40 kD); Clone BA 17
A00094.0025	ScyTek Laboratories	25 ml	EUR 616.8

FGF-19 Recombinant Protein
40-178-0005mg	ProSci	0.005 mg	EUR 311.1
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during the brain development and embryogenesis. Recombinant human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues.

FGF-19 Recombinant Protein
40-178-0025mg	ProSci	0.025 mg	EUR 437.1
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during the brain development and embryogenesis. Recombinant human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues.

IL-19 Recombinant Protein
40-264-0002mg	ProSci	0.002 mg	EUR 311.1
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant Human IL-19 is a 35.8 kDa homodimer of two 154 amino acid chains. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.

IL-19 Recombinant Protein
40-264-001mg	ProSci	0.01 mg	EUR 437.1
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant Human IL-19 is a 35.8 kDa homodimer of two 154 amino acid chains. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.

FGF-19 Fibroblast Growth Factor-19 Human Recombinant Protein
PROTO95750-1	BosterBio	Regular: 25ug	EUR 380.4
Description: FGF19 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 195 amino acids and having a molecular mass of 21.8 kDa.;The FGF-19 is purified by proprietary chromatographic techniques.

TESTO (Testosterone) ELISA test
19	Biobase	96T/Box	Ask for price
Description: ELISA based test for quantitative detection of O (osterone)

Anti-MMP-19 Antibody
A05171-1	BosterBio	100ul	EUR 476.4
Description: Rabbit Polyclonal Antibody for MMP-19 Antibody (MMP19) detection.tested for WB in Human, Mouse.

Anti-Claudin-19 Antibody
A08096-1	BosterBio	100ul	EUR 476.4
Description: Rabbit Polyclonal Antibody for Claudin-19 Antibody (CLDN19) detection. Tested with WB in Human, Rat.

Anti-TCF-19 Antibody
A10508-1	BosterBio	100ul	EUR 476.4
Description: Rabbit Polyclonal Antibody for TCF-19 Antibody (TCF19) detection. Tested with WB in Human, Mouse, Rat.

Polyclonal KRT19 / CK19 / Cytokeratin 19 Antibody (aa21-40)
APR17075G	Leading Biology	0.05mg	EUR 580.8
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human KRT19 / CK19 / Cytokeratin 19 (aa21-40). This antibody is tested and proven to work in the following applications:

Anti-Cytokeratin 19
DB-103-1	DB Biotech	1 ml	EUR 540
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Abeta 40 (beta amyloid 1-40)
RA25009	Neuromics	100 ul	EUR 459.6

CORNING® REUSABLE PHENOLIC GPI 40-400 THREADED SCREW CAP WITH RUBBER LINER
9999-40	CORNING	72/pk	EUR 168
Description: General Apparatus; Stoppers

ExoDNAPS? Circulating and Exosome-associated DNA Extraction Kit (Human Plasma/Serum, 40 reactions)
K1230-40	Biovision		EUR 1273.2

ExoDNAUC? Circulating and Exosome-associated DNA Extraction Kit (Urine/Cell Media, 40 reactions)
K1231-40	Biovision		EUR 1273.2

FGF-19, human recombinant protein
P1050-.1	ApexBio	100 µg	EUR 885.6
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis.

FGF-19, human recombinant protein
P1050-1	ApexBio	1 mg	EUR 4987.2
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis.

Recombinant Human IL-19 Protein
PROTQ9UHD0-1	BosterBio	10ug	EUR 380.4
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant human IL-19 is a 17.9 kDa protein containing 153 amino acid residues. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.

Human Cyclophilin-40 (PPID) AssayMax ELISA Kit
EC2050-1	AssayPro	96 Well Plate	EUR 500.4

40 bp random library with flanking sequence; DNA aptamer
DAL-N-40	Alpha Diagnostics	100 ug	EUR 489.6

DiagNano Gold Nanoparticle Medium Covalent Conjugation Kit, 40 nm
GCK-M-40	Creative Diagnostics	1 kit	EUR 908.4

DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm, Cellular Uptake
GFL-40-CU	Creative Diagnostics	1mL	EUR 1638

[Ser25] Protein Kinase C (19-31)
A1033-1	ApexBio	1 mg	EUR 122.4
Description: Protein Kinase C (19-31), (C67H118N26O17), a peptide with the sequence H-ARG-PHE-ALA-ARG-LYS-GLY-SER-LEU-ARG-GLN-LYS-ASN-VAL-OH, MW= 1559.82.

Anti-Cytokeratin 19 Rabbit Monoclonal Antibody
M02101-1	BosterBio	100ug/vial	EUR 476.4
Description: Rabbit Monoclonal Cytokeratin 19 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse.

DiagNano Gold Nanorods, diameter 40 nm, absorption max 550 nm
BR-40-550	Creative Diagnostics	25 mL	EUR 864

DiagNano Gold Nanorods, diameter 40 nm, absorption max 600 nm
BR-40-600	Creative Diagnostics	25 mL	EUR 864

DiagNano Gold Nanorods, diameter 40 nm, absorption max 650 nm
BR-40-650	Creative Diagnostics	25 mL	EUR 864

DiagNano Gold Nanorods, diameter 40 nm, absorption max 750 nm
BR-40-750	Creative Diagnostics	25 mL	EUR 864

DiagNano Gold Nanorods, diameter 40 nm, absorption max 780 nm
BR-40-780	Creative Diagnostics	25 mL	EUR 864

DiagNano Gold Nanorods, diameter 40 nm, absorption max 808 nm
BR-40-808	Creative Diagnostics	25 mL	EUR 864

DiagNano Gold Nanorods, diameter 40 nm, absorption max 850 nm
BR-40-850	Creative Diagnostics	25 mL	EUR 864

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 550 nm
OR-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 600 nm
OR-40-600	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 650 nm
OR-40-650	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 700 nm
OR-40-700	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 750 nm
OR-40-750	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFA-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFA-40-650	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFA-40-700	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFA-40-750	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFB-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFB-40-600	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFB-40-650	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFB-40-750	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFC-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFC-40-600	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFC-40-650	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFC-40-700	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFC-40-750	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFM-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFM-40-650	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFM-40-700	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFM-40-750	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFN-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFN-40-600	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFN-40-650	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFN-40-700	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFN-40-750	Creative Diagnostics	1 mL	EUR 1226.4

egg white lysozyme (19-36) [Gallus gallus]
A1065-1	ApexBio	1 mg	EUR 129.6
Description: Sequence: H2N-KVFGRCELAAAMKRHGLD-OHFormula of Egg white lysozyme (19-36) [Gallus gallus]:C86H144N28O23S2Hen egg white lysozyme has a molecular weight of about 14,600 and each molecule comprises 129 amino acid residues1.

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody
20-abx132222	Abbexa	EUR 510.00 EUR 159.60 EUR 1412.40 EUR 693.60 EUR 393.60	100 ug 10 ug 1 mg 200 ug 50 ug

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody
20-abx175368	Abbexa	EUR 477.60 EUR 159.60 EUR 1312.80 EUR 644.40 EUR 376.80	100 ug 10 ug 1 mg 200 ug 50 ug

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody
20-abx175369	Abbexa	EUR 493.20 EUR 159.60 EUR 1362.00 EUR 661.20 EUR 376.80	100 ug 10 ug 1 mg 200 ug 50 ug

Synthetic Amyloid Beta Peptide 1-40 (Ab1-40)
4-SPA864Hu02	Cloud-Clone	EUR 421.06 EUR 236.40 EUR 1248.96 EUR 496.32 EUR 872.64 EUR 357.60 EUR 2942.40	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RCG-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RCG-40-600	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RCG-40-650	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RCG-40-700	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RCG-40-750	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RCN-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RCN-40-600	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RCN-40-650	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RCN-40-700	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RCS-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RCS-40-600	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RCS-40-700	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RCS-40-750	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFL-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFL-40-600	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFL-40-650	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFL-40-700	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFL-40-750	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RGS-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RGS-40-650	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RGS-40-700	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RGS-40-750	Creative Diagnostics	1 mL	EUR 1226.4

beta-Amyloid(40-1)
5-00456	CHI Scientific	4 x 1mg	Ask for price

β-Amyloid (1-40)
HY-P0265	MedChemExpress	5mg	EUR 704.4

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RCA-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RCA-40-600	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RCA-40-650	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RCA-40-700	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RCA-40-750	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 550 nm
RCK-40-550	Creative Diagnostics	1 kit	EUR 1251.6

DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 600 nm
RCK-40-600	Creative Diagnostics	1 kit	EUR 1251.6

DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 650 nm
RCK-40-650	Creative Diagnostics	1 kit	EUR 1251.6

DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 700 nm
RCK-40-700	Creative Diagnostics	1 kit	EUR 1251.6

DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 750 nm
RCK-40-750	Creative Diagnostics	1 kit	EUR 1251.6

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide
20-abx652283	Abbexa	EUR 376.80 EUR 243.60 EUR 927.60 EUR 410.40 EUR 309.60	100 ug 10 ug 1 mg 200 ug 50 ug

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide
abx670346-1mg	Abbexa	1 mg	EUR 627.6

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Hu11	Cloud-Clone	EUR 266.23 EUR 194.40 EUR 668.35 EUR 302.78 EUR 485.57 EUR 253.20 EUR 1490.88	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Hu21	Cloud-Clone	EUR 517.82 EUR 261.60 EUR 1611.84 EUR 617.28 EUR 1114.56 EUR 422.40 EUR 3849.60	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Hu23	Cloud-Clone	EUR 409.22 EUR 232.80 EUR 1204.61 EUR 481.54 EUR 843.07 EUR 349.20 EUR 2831.52	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Hu31	Cloud-Clone	EUR 295.26 EUR 202.80 EUR 777.22 EUR 339.07 EUR 558.14 EUR 272.40 EUR 1763.04	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Mu11	Cloud-Clone	EUR 266.23 EUR 194.40 EUR 668.35 EUR 302.78 EUR 485.57 EUR 253.20 EUR 1490.88	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Mu21	Cloud-Clone	EUR 266.23 EUR 194.40 EUR 668.35 EUR 302.78 EUR 485.57 EUR 253.20 EUR 1490.88	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Mu31	Cloud-Clone	EUR 295.26 EUR 202.80 EUR 777.22 EUR 339.07 EUR 558.14 EUR 272.40 EUR 1763.04	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Ra11	Cloud-Clone	EUR 266.23 EUR 194.40 EUR 668.35 EUR 302.78 EUR 485.57 EUR 253.20 EUR 1490.88	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Ra21	Cloud-Clone	EUR 266.23 EUR 194.40 EUR 668.35 EUR 302.78 EUR 485.57 EUR 253.20 EUR 1490.88	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Ra31	Cloud-Clone	EUR 295.26 EUR 202.80 EUR 777.22 EUR 339.07 EUR 558.14 EUR 272.40 EUR 1763.04	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

Rat beta-40(Amyloid Beta 1-40) ELISA Kit
STJ150091	St John's Laboratory	1 kit	EUR 494.4
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Rat serum, plasma and other biological fluids

Human amyloid beta peptide 1-40,A?1-40 ELISA Kit
201-12-1231	SunredBio	96 tests	EUR 528
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
CSB-E08299h-24T	Cusabio	1 plate of 24 wells	EUR 198
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid (CSF). A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
1-CSB-E08299h	Cusabio	EUR 1080.00 EUR 6571.20 EUR 3480.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid(CSF). Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
CSB-E08300m-24T	Cusabio	1 plate of 24 wells	EUR 198
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
1-CSB-E08300m	Cusabio	EUR 1135.20 EUR 6938.40 EUR 3672.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
CSB-E08302r-24T	Cusabio	1 plate of 24 wells	EUR 198
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
1-CSB-E08302r	Cusabio	EUR 1160.40 EUR 7110.00 EUR 3760.80	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

ELISA kit for Human A?1-40 (Amyloid Beta 1-40)
E-EL-H0542	Elabscience Biotech	1 plate of 96 wells	EUR 452.4
Description: A sandwich ELISA kit for quantitative measurement of Human A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Rat A?1-40 (Amyloid Beta 1-40)
E-EL-R1401	Elabscience Biotech	1 plate of 96 wells	EUR 452.4
Description: A sandwich ELISA kit for quantitative measurement of Rat A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Mouse A?1-40 (Amyloid Beta 1-40)
E-EL-M0067	Elabscience Biotech	1 plate of 96 wells	EUR 452.4
Description: A sandwich ELISA kit for quantitative measurement of Mouse A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Monkey A?1-40 (Amyloid Beta 1-40)
E-EL-MK0477	Elabscience Biotech	1 plate of 96 wells	EUR 700.8
Description: A sandwich ELISA kit for quantitative measurement of Monkey A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant

Beta 2 Microglobulin (B2M) Partially Pure (40-90%)
B2M17-N-1	Alpha Diagnostics	1 mg	EUR 343.2

DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RRG-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RRG-40-600	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RRG-40-650	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RRG-40-700	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RRG-40-750	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RHA-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RHA-40-600	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RHA-40-650	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RHA-40-750	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RHG-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RHG-40-600	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RHG-40-650	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RHG-40-700	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RHG-40-750	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RHM-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RHM-40-600	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RHM-40-650	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RHM-40-700	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RHM-40-750	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RMG-40-550	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RMG-40-600	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RMG-40-650	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RMG-40-700	Creative Diagnostics	1 mL	EUR 1226.4

DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RMG-40-750	Creative Diagnostics	1 mL	EUR 1226.4

KRT19 Human, Cytokeratin 19 Human Recombinant Protein , His Tag
PROTP08727-1	BosterBio	Regular: 20ug	EUR 380.4
Description: KRT19 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 423 amino acids (1-400) and having a molecular mass of 46.5kDa.;KRT19 is fused to a 23 amino acid His-Tag at N-terminus and purified by proprietary chromatographic techniques.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
20-abx150496	Abbexa	EUR 7970.40 EUR 4250.40 EUR 990.00	10 × 96 tests 5 × 96 tests 96 tests

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
20-abx155127	Abbexa	EUR 8684.40 EUR 4626.00 EUR 1074.00	10 × 96 tests 5 × 96 tests 96 tests

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
20-abx153576	Abbexa	EUR 7970.40 EUR 4250.40 EUR 990.00	10 × 96 tests 5 × 96 tests 96 tests

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)
20-abx165634	Abbexa	EUR 727.20 EUR 309.60 EUR 2180.40 EUR 861.60 EUR 526.80	100 ug 10 ug 1 mg 200 ug 50 ug

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
abx053393-96tests	Abbexa	96 tests	EUR 801.6

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
20-abx053394	Abbexa	EUR 8365.20 EUR 4456.80 EUR 1036.80	10 × 96 tests 5 × 96 tests 96 tests

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
20-abx053396	Abbexa	EUR 8684.40 EUR 4626.00 EUR 1074.00	10 × 96 tests 5 × 96 tests 96 tests

Chicken Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
abx357155-96tests	Abbexa	96 tests	EUR 990

Pig Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
abx361651-96tests	Abbexa	96 tests	EUR 990

Accugel 19:1 40%